DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and SEC14L6

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_016884420.1 Gene:SEC14L6 / 730005 HGNCID:40047 Length:432 Species:Homo sapiens


Alignment Length:280 Identity:50/280 - (17%)
Similarity:95/280 - (33%) Gaps:54/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DHTAEQIFKIEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRH--PTW 71
            |.:..|...:.|.|:.::.........:|..|.::|....:|..|:...:..:.||:::.  ...
Human    10 DLSPSQEKSLAQFRENIQDVLSALPNPDDYFLLRWLQARSFDLQKSEDMLRKHMEFRKQQDLANI 74

  Fly    72 VARHPIEHYRQLFYGTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMDDL--IFESLL 134
            :|..|.|..|.......|.:       .|....|:..:.|..|....|.|..:.:.|  .|.|..
Human    75 LAWQPPEVVRLYNANGICGH-------DGEGSPVWYHIVGSLDPKGLLLSASKQELLRDSFRSCE 132

  Fly   135 LLPR-----------VQQNGITVICDLQGTNRNFL-------RQFSPAFMKVVN----EKNGVLP 177
            ||.|           .:..||:...|.:|.....:       ::......|::.    |..|:..
Human   133 LLLRECELQSQKPHWTRGTGISAPLDRRGNCNTAIWPPMDRHKELGKRVEKIIAIFGLEGLGLRD 197

  Fly   178 FSQRIVHIIQRGF---------------------LMHVTSTLFMPFMNKEFKEKIFTHDGRHLSK 221
            ..:..:.::|..|                     |..|...|...:|::|.:.|:.........:
Human   198 LWKPGIELLQEFFSALEANYPEILKSLIVVRAPKLFAVAFNLVKSYMSEETRRKVVILGDNWKQE 262

  Fly   222 LREMVGYESLPAEYGGPATN 241
            |.:.:..:.||.|:||..|:
Human   263 LTKFISPDQLPVEFGGTMTD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 7/43 (16%)
CRAL_TRIO 92..237 CDD:279044 31/189 (16%)
SEC14L6XP_016884420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.