DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and Sec14l5

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001121197.1 Gene:Sec14l5 / 665119 MGIID:3616084 Length:696 Species:Mus musculus


Alignment Length:293 Identity:61/293 - (20%)
Similarity:112/293 - (38%) Gaps:69/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRH------PTWVARHPIE 78
            |||..:::....::..::.:| :||....:...||...:.....::::|      .||....|: 
Mouse   248 QLRHWLQETHKGKIPKDEHIL-RFLRARDFHLDKARDMLCQSLSWRKQHQVDLLLQTWRPPPPL- 310

  Fly    79 HYRQLFY--GTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMD-----DLIFESLLL- 135
               |.||  |.|                 ::.:||   .|.|:..|.:||     ..:.|..|| 
Mouse   311 ---QEFYAGGWH-----------------YQDIDG---RPLYILRLGQMDTKGLMKAVGEEALLQ 352

  Fly   136 -LPRVQQNG-----------------ITVICDLQGTN-RNFLRQFSPAFMKVVNEKNGVLPFSQR 181
             :..|.:.|                 .|.:.||:|.| |:..|....|.::::.......|.:..
Mouse   353 HVLSVNEEGQKRCEGNTRQFGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLG 417

  Fly   182 IVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGY---ESLPAEYGGPAT-NV 242
            .:.|::...:..|..||..||:|:..:.|...:.|.:......:|.|   :.:|...||.:. ||
Mouse   418 RLLIVRAPRVFPVLWTLVSPFINENTRRKFLIYSGSNYQGPGGLVDYLDKDVIPDFLGGESVCNV 482

  Fly   243 LDTNLIFNHL---SQNAEYLEKLQ----TYGKA 268
            .:..::...|   .:..|..::||    ||..|
Mouse   483 PEGGMVPKSLYLTEEEQEQADQLQQWSETYHSA 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 8/40 (20%)
CRAL_TRIO 92..237 CDD:279044 33/172 (19%)
Sec14l5NP_001121197.1 PRELI 17..173 CDD:368069
CRAL_TRIO_N 243..288 CDD:215024 8/40 (20%)
SEC14 306..479 CDD:214706 41/196 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.