DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and RLBP1

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:256 Identity:55/256 - (21%)
Similarity:108/256 - (42%) Gaps:47/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DHTAEQIFKIEQLRQLVE----KCEDLRVGTEDTLLTK----FLHYTR---WDTIKAYQAIHDYY 62
            :.|.|:  .:.:|:::|:    ..|:|.|...:.:..|    ||.:.|   ::..:||:.:..|.
Human    65 EETREE--AVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYV 127

  Fly    63 EFKRRHPTWVARHPIEHYRQLF-----YGTHCRY------VMPQADRSGRVLVVFKTVDGFQDYP 116
            .|:.::|            :||     ....|..      |:...|:.|||:::| .::.:|...
Human   128 NFRLQYP------------ELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLF-NIENWQSQE 179

  Fly   117 DYLQSLVEMDDLIFESLLLLPRVQQNGITVICDLQGTNRNFLRQFSPA-----FMKVVNEKNGVL 176
            .....:::....|.|.||.....|.||..:|.:.:|    |..|.:.:     ..|:|:......
Human   180 ITFDEILQAYCFILEKLLENEETQINGFCIIENFKG----FTMQQAASLRTSDLRKMVDMLQDSF 240

  Fly   177 PFSQRIVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGG 237
            |...:.:|.|.:.:....|..:..||:..:..|::|.| |..||...:.:....||:::||
Human   241 PARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVH-GDDLSGFYQEIDENILPSDFGG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 11/54 (20%)
CRAL_TRIO 92..237 CDD:279044 34/149 (23%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.