DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and sec14l5

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_031749906.1 Gene:sec14l5 / 493292 XenbaseID:XB-GENE-953433 Length:793 Species:Xenopus tropicalis


Alignment Length:284 Identity:65/284 - (22%)
Similarity:105/284 - (36%) Gaps:79/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLTARVDHTAEQIFKIEQLRQLVEKCEDLRVGTE---DTLLTKFLHYTRWDTIKAYQAIHDYYEF 64
            ||.||       .|.|::.|:::  |:.|....:   |.||      :.||   ..|.:||||..
 Frog   283 FLRAR-------DFNIDKAREIL--CQSLTWRKQHHVDYLL------STWD---PPQVLHDYYAG 329

  Fly    65 KRRHPTWVARHPIEHYRQLFYGTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMDDLI 129
            ...|                   |        ||.||.|.|.:.  |..|....:::|.|     
 Frog   330 GWHH-------------------H--------DRDGRPLYVLRL--GQMDTKGLVRALGE----- 360

  Fly   130 FESLLL---------LPRVQQN---------GITVICDLQGTN-RNFLRQFSPAFMKVVNEKNGV 175
             ||||.         |.|.::|         ..|.:.||:|.| |:..|....|.::::......
 Frog   361 -ESLLRHVLSINEEGLRRCEENTNIFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEAN 424

  Fly   176 LPFSQRIVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGY---ESLPAEYGG 237
            .|.:...:.|::...:..|..||..||:::..::|...:.|........::.|   |.:|...||
 Frog   425 YPETLGRLLILRAPRVFPVLWTLVSPFIDENTRKKFLIYAGNDYQGPGGLIDYIDKEVIPDFLGG 489

  Fly   238 PA-TNVLDTNLIFNHLSQNAEYLE 260
            .. ..|.:..::...|.:..|.||
 Frog   490 ECMCEVSEGGMVPKALYRTPEELE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 11/46 (24%)
CRAL_TRIO 92..237 CDD:279044 37/166 (22%)
sec14l5XP_031749906.1 PRELI 17..173 CDD:398400
CRAL_TRIO_N 256..301 CDD:215024 8/26 (31%)
CRAL_TRIO 326..490 CDD:395525 42/198 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.