DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and CG10300

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster


Alignment Length:282 Identity:60/282 - (21%)
Similarity:110/282 - (39%) Gaps:47/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DHTAEQIFKIEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHPTWVA 73
            :..|::...|..::..:.|...|:..|::.|:..||...|:...:..:...:||..:...|..:.
  Fly    22 EEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEVLG 86

  Fly    74 RHPIEH--YRQLFYGTHCRYVMPQADRSGRVLV-VFKTVDGFQDYPDYLQSLVEMDDLIFESLLL 135
            ...::.  ..||..|.|...:.|.:....||:: .|:.:|..:..|.      |...|||..|.|
  Fly    87 SRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPR------EAFKLIFIMLEL 145

  Fly   136 LPRVQQN----GITVICDLQGTNRNFLRQFSPAFMK----VVNEKNGVLPFSQRIVHII---QRG 189
            |.....|    |:..:.|.:......:.|:.|..:|    :|::   .:|.....:|:|   :.|
  Fly   146 LALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQ---CIPLRFVEIHMINMRKEG 207

  Fly   190 FLMHVTSTLFMP------FMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPATNVLDTNLI 248
            ..:....|.|:|      |:..:..|.::.|..|           :.:..||||  ||......:
  Fly   208 QTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPR-----------DVMTIEYGG--TNGYQAEAV 259

  Fly   249 FNH----LSQNAEYLEKLQTYG 266
             :|    |..:.:||.|...||
  Fly   260 -DHWRQKLLDSKDYLAKDAQYG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 8/43 (19%)
CRAL_TRIO 92..237 CDD:279044 33/162 (20%)
CG10300NP_651174.2 SEC14 95..251 CDD:238099 39/177 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.