DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and CG2663

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster


Alignment Length:236 Identity:56/236 - (23%)
Similarity:99/236 - (41%) Gaps:15/236 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHPTWVARHPI--EHY 80
            |:.:|:.:|....|....:|..||.||...::...|..:.:..||..:...|.:.:...|  |..
  Fly    31 IKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKKKLDMYYTMRNAVPEFFSNRDINREEL 95

  Fly    81 RQLFYGTHCRYVMPQADRSGRVLVVFKTVD-GFQDYPDYLQSLVEMDDLIFESLLLLPRVQQNGI 144
            ..:....||. .:|....:||.:...:.:| .||  |.::...:::..:|.:..|....|...|.
  Fly    96 NIVLDYVHCP-TLPGITPNGRRITFIRGIDCDFQ--PHHILDAMKVALMIGDVRLAEESVGIAGD 157

  Fly   145 TVICDLQGTNRNFLRQFSPA----FMKVVNEKNGVLPFSQRIVHIIQRGFLMHVTSTLFMPFMNK 205
            ..|.|....:.....:|||.    |:..|.|   ..|...:.||:|....|:........||:.:
  Fly   158 IFILDASVASAAHFAKFSPTVVKKFLIAVQE---AYPVKVKEVHVINISPLVDTIFNFVKPFVKE 219

  Fly   206 EFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPATNVLDTN 246
            :.:.:|..|:  .:..|.::|..:.||.||||.|..|::.|
  Fly   220 KIRSRITFHN--DVESLYKVVPRDLLPNEYGGKAGGVVELN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 10/42 (24%)
CRAL_TRIO 92..237 CDD:279044 34/149 (23%)
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 10/42 (24%)
SEC14 95..250 CDD:238099 37/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.