DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and rlbp1a

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_956999.1 Gene:rlbp1a / 393678 ZFINID:ZDB-GENE-040426-1662 Length:312 Species:Danio rerio


Alignment Length:273 Identity:65/273 - (23%)
Similarity:116/273 - (42%) Gaps:49/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DHTAE------------QIFKIEQLRQLVE----------KCEDLRVGTE-DTLLTKFLHYTRWD 50
            |||.:            :...|::||.:::          |....:.|.| |:||.:|:...::|
Zfish    41 DHTKQKAKDELNETDEKRASAIKELRAMIKDKAGQGDEVAKTVQDKFGKEPDSLLLRFIRARKFD 105

  Fly    51 TIKAYQAIHDYYEFKRRHPTWVARHPIEHYRQLFYGTHCRYVMPQADRSGRVLVVFKTVDGFQDY 115
            ..:|::.:..|..|:|.:|........|..|......:.| ::...|::|||:::| .:|.:.  
Zfish   106 VARAHELMKGYVRFRRDYPELFENLTPEAVRSTIEAGYPR-ILSTRDKNGRVVLLF-NIDNWD-- 166

  Fly   116 PDYLQSLVEMDD------LIFESLLLLPRVQQNGITVICDLQGTNRNFLRQFSPA-----FMKVV 169
               |:. |..|:      :|.|.||.....|.||..:|.:.:|    |..|.:..     ..|:|
Zfish   167 ---LEE-VTFDETLRAYCVILEKLLENEETQINGFVLIENFKG----FTMQHASGIKHTELKKMV 223

  Fly   170 NEKNGVLPFSQRIVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAE 234
            :......|...:.||:|.:.:....|..:..|||..:..|::|.|.......||:. |.|.||.:
Zfish   224 DMLQDSFPARFKAVHVIHQPWYFTTTYNVVKPFMKSKLLERVFVHGDELDGYLRDF-GAEILPPD 287

  Fly   235 YG--GPATNVLDT 245
            :.  |||.:..:|
Zfish   288 FDGTGPACDGRET 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 12/54 (22%)
CRAL_TRIO 92..237 CDD:279044 39/157 (25%)
rlbp1aNP_956999.1 CRAL_TRIO_N 59..116 CDD:215024 12/56 (21%)
CRAL_TRIO 142..291 CDD:279044 40/161 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.