DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and Cralbp

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster


Alignment Length:245 Identity:62/245 - (25%)
Similarity:97/245 - (39%) Gaps:38/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TAEQIFKIEQLRQLVEKCEDLR-VGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHPTWVAR 74
            |.||  .:||||..|.|.|||: |..:||.|.:||...::....|.|.:..|...:|..|     
  Fly    29 TREQ--SLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTFP----- 86

  Fly    75 HPIEHY-RQLFY---------GTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMDDLI 129
                |. .||.|         .....:.:||.|:.||.:||. ...|............:...|.
  Fly    87 ----HMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVI-NAKGLNPKIHTSCDQAKAHFLT 146

  Fly   130 FESLLLLPRVQQNGITVICDLQGTNRNFLRQFSPA-FMKVVNEKNGVLPFSQRIVHIIQRGFLMH 193
            :|.|:.....|..|:|.:.|..|.....:..::|. |.::.......||...:.:|:|      :
  Fly   147 YECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHKEIHLI------N 205

  Fly   194 VTSTL--FMPF----MNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGG 237
            |.|||  .:.|    ::.:.|.::..:...  .:|.:.|....||.|.||
  Fly   206 VPSTLKWLIDFVKNRVSSKMKNRLIIYGSE--KELMKSVDQGCLPLEMGG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 17/44 (39%)
CRAL_TRIO 92..237 CDD:279044 33/151 (22%)
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 19/48 (40%)
SEC14 101..254 CDD:238099 35/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.