DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and CG13893

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster


Alignment Length:267 Identity:60/267 - (22%)
Similarity:102/267 - (38%) Gaps:64/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EQLRQLVEK----CEDLRVGT-EDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRH-------PTW 71
            |:.|.::||    .:|..||| :|..|.::|...:|:...|.:.:.  ...|.|.       ..|
  Fly    10 EEQRAILEKFRKQMDDALVGTHDDYFLVRWLRARKWNLEAAEKMLR--ASLKTRAMWNVDNIEKW 72

  Fly    72 VARHPIEHYRQLFYGTHCRYVMPQADRSGRVLVV-FKTVD-----------GFQDYPDYLQSLVE 124
            .....::.|  |.||     :|...:....|||. |...|           .||.|      || 
  Fly    73 DPPKALQEY--LPYG-----LMGYDNEGSPVLVCPFANFDMWGMMHCVTRFEFQKY------LV- 123

  Fly   125 MDDLIFESLLLL--PRVQQNG-----ITVICDLQGTNRNFLRQFS--PA---FMKVVNEKNGVLP 177
               |:.|..:.:  .:.|::|     :.|..|:|..|   |:|::  ||   .:..|.:.....|
  Fly   124 ---LLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVN---LKQYAWRPAAECVISTVKQYEANFP 182

  Fly   178 FSQRIVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDG---RHLSKLREMVGYESLPAEYGGPA 239
            ...::.:||....|..|...:...|:::....||..:..   |...:|...|..::.|..:||  
  Fly   183 ELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGG-- 245

  Fly   240 TNVLDTN 246
             .::|.|
  Fly   246 -EMVDRN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 13/46 (28%)
CRAL_TRIO 92..237 CDD:279044 36/171 (21%)
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 11/42 (26%)
SEC14 75..246 CDD:238099 42/193 (22%)
GOLD_2 303..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.