DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and Sec14l1

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:263 Identity:54/263 - (20%)
Similarity:103/263 - (39%) Gaps:64/263 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRH------PTWVARHPIE 78
            :|||.:::....::..::.:| :||....::..||.:.:.....::::|      .||.....::
  Rat   262 RLRQWLQETHKGKIPKDEHIL-RFLRARDFNIDKAREIMCQSLTWRKQHQVDYILDTWTPPQVLQ 325

  Fly    79 HYRQLFY--GTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMDDLIFESLLL------ 135
            .|    |  |.|      ..|:.||.|.|.:.  |..|....:::|.|      |:||.      
  Rat   326 DY----YAGGWH------HHDKDGRPLYVLRL--GQMDTKGLVRALGE------EALLRYVLSIN 372

  Fly   136 ---LPRVQQN---------GITVICDLQGTN-RNFLRQFSPAFMKVVNEKNGVLPFSQRIVHIIQ 187
               |.|.::|         ..|.:.||:|.| |:..|....|.::::.......|.:...:.|::
  Rat   373 EEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILR 437

  Fly   188 RGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPA--TNVLDTNLIFN 250
            ...:..|..||..||::...:.|...:.|.                :|.||.  .:.:|..:|.:
  Rat   438 APRVFPVLWTLVSPFIDDNTRRKFLIYAGN----------------DYQGPGGLLDYIDKEIIPD 486

  Fly   251 HLS 253
            .||
  Rat   487 FLS 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 8/40 (20%)
CRAL_TRIO 92..237 CDD:279044 33/163 (20%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 8/40 (20%)
CRAL_TRIO 327..491 CDD:279044 43/197 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.