DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and CG12926

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster


Alignment Length:291 Identity:60/291 - (20%)
Similarity:104/291 - (35%) Gaps:67/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVDHTAEQIFKIEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHPTW 71
            |:|.      .||.||..:.|...|:...:...|..||...::...|....:.::|..:...|  
  Fly    30 RIDE------DIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKLDNFYAMRGAVP-- 86

  Fly    72 VARHPIEHYRQLFYG--------THCRYVMPQADRSGRVLVVFKTVDG----FQDYPDY------ 118
                  |.|:....|        |.|...:||..::          ||    ...|..|      
  Fly    87 ------ELYKNRIVGEKQLSILDTGCLLRLPQPLQA----------DGPRIHISRYGQYDSKKYS 135

  Fly   119 LQSLVEMDDLIFESLLLLPRVQQN----GITVICDLQGTNRNFLRQFSPAFMK---VVNEKNGVL 176
            :..:|:::.::.|..:   |...|    |...|.|::|.....|.||....:|   |:.:|  ..
  Fly   136 IAEVVQVNTMLGEIQI---REDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDK--AY 195

  Fly   177 PFSQRIVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPATN 241
            |:..:..|.:..........::....|:::.:::...|.  .|..|.:.|..|.|||||||....
  Fly   196 PYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIHS--KLDSLYKYVPKECLPAEYGGSNGT 258

  Fly   242 VLD------TNLIFNHLSQNAEYLEKLQTYG 266
            :.|      |.|:     ....:.|:..:||
  Fly   259 IQDVVSTWRTKLL-----AYKPFFEEEASYG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 10/43 (23%)
CRAL_TRIO 92..237 CDD:279044 33/161 (20%)
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 11/50 (22%)
SEC14 117..254 CDD:238099 31/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.