DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and CG10026

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:234 Identity:55/234 - (23%)
Similarity:106/234 - (45%) Gaps:29/234 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IEQLRQLV---EKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHPTWVAR-HPIE 78
            |||.|..:   .:|:..|  ::...|.|||....|....:|:.:..||.|:.::.::..: .|::
  Fly    46 IEQFRNYILEHNECQPHR--SDAKYLEKFLRARYWKIENSYKLLCSYYRFREQNKSFYEKVRPLD 108

  Fly    79 --HYRQLFYGTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMDDLIFESLLLL----- 136
              |..|    :....|.|..|:.|..:::::       :..:..:.|.:|| ||.:.::|     
  Fly   109 LRHVGQ----SDILTVTPYRDQHGHRILIYR-------FGLWRPNQVTVDD-IFRATIVLQELGS 161

  Fly   137 --PRVQQNGITVICDLQGTNRNFLRQFSPAF-MKVVNEKNGVLPFSQRIVHIIQRGFLMHVTSTL 198
              |..|..|...|.||:......:...||:. .|::......:|.....:||:.:.::.:....:
  Fly   162 LEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKI 226

  Fly   199 FMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGG 237
            |.||:|...:||::.| |..::.|.:.:..|.||..|||
  Fly   227 FKPFLNAAMREKLYIH-GSDMTSLHKHINPEHLPKRYGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 12/45 (27%)
CRAL_TRIO 92..237 CDD:279044 35/152 (23%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 12/45 (27%)
SEC14 112..265 CDD:238099 38/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.