DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and Ku80

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster


Alignment Length:190 Identity:41/190 - (21%)
Similarity:68/190 - (35%) Gaps:61/190 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RVLVVFKTVDGFQDYPDYLQSLVEM-DDLIFESLLLLPRVQQNGITVICDLQGTNR-----NFLR 159
            |:|::|    .|.|:|...:...|: |:|:.|::.|:  |..:.|..| |...|::     ||.|
  Fly   122 RILLLF----DFNDFPQDYEKFNEITDELLGENIELI--VGTHNIAYI-DNAITSQPQAIFNFSR 179

  Fly   160 QFSP----------------------------AFMKVVNEK----NGVLPFSQRIVHIIQRGFLM 192
            :..|                            ...||.|.:    |..|....:|...:|....|
  Fly   180 KCGPDELNNQKYALSLVPRCNATLCSFKEALHTVFKVTNRRPWVWNAKLNIGSKISISLQGIIAM 244

  Fly   193 HVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPATNVLDTNLIFNHL 252
            ...:.:.:..:..| |::|...:.||..|     |.|..|          |..|||..::
  Fly   245 KNQTPVKLVKVWAE-KDEIVIRETRHYIK-----GTEITP----------LPENLITGYM 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024
CRAL_TRIO 92..237 CDD:279044 37/173 (21%)
Ku80NP_609767.2 Ku_N 7..213 CDD:281693 20/97 (21%)
KU80 221..524 CDD:238445 18/84 (21%)
Ku_PK_bind 562..663 CDD:285938
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.