DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and SEC14L3

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_011528430.1 Gene:SEC14L3 / 266629 HGNCID:18655 Length:412 Species:Homo sapiens


Alignment Length:260 Identity:59/260 - (22%)
Similarity:107/260 - (41%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTARV-DHTAEQIFKIEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRR 67
            ::.|| |.:.:|...:.:.|:.|:.........:|..|.::|....:|..|:...:..|.||::.
Human     1 MSGRVGDLSPKQAETLAKFRENVQDVLPALPNPDDYFLLRWLRARNFDLQKSEALLRKYMEFRKT 65

  Fly    68 HP-----TWVARHPIEHYRQLFYGTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMD- 126
            ..     .|   .|.|..::...|..|.|     ||.|  ..|:..:.|..|....|.|:.:.| 
Human    66 MDIDHILDW---QPPEVIQKYMPGGLCGY-----DRDG--CPVWYDIIGPLDPKGLLFSVTKQDL 120

  Fly   127 ---------DLIFESLLLLPRVQQ--NGITVICDLQGTNRNFLRQFSPAFMKVVNEKNGVL---- 176
                     .::.|..|...|:.:  ..|.:|.|.:|..   |:.|....::|..|..|:|    
Human   121 LKTKMRDCERILHECDLQTERLGKKIETIVMIFDCEGLG---LKHFWKPLVEVYQEFFGLLEENY 182

  Fly   177 PFSQRIVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPATN 241
            |.:.:.:.|::...|..|...|..||::::.:.||..........|.:::..|.|||::||..|:
Human   183 PETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLLKLISPEELPAQFGGTLTD 247

  Fly   242  241
            Human   248  247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 7/43 (16%)
CRAL_TRIO 92..237 CDD:279044 36/160 (23%)
SEC14L3XP_011528430.1 CRAL_TRIO_N 13..59 CDD:215024 7/45 (16%)
SEC14 76..245 CDD:214706 43/178 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.