DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and Ttpa

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_037180.1 Gene:Ttpa / 25571 RGDID:3915 Length:278 Species:Rattus norvegicus


Alignment Length:247 Identity:66/247 - (26%)
Similarity:110/247 - (44%) Gaps:40/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHPTWVA-RHPIEHYRQLFYGTHCRYVMPQADRSG 100
            |..|.:||....:|...|::.:.:||:::...|...| .||......|..|.|  .|:...|.:|
  Rat    49 DAFLLRFLRARDFDLDLAWRLMKNY
YKWRAECPELSADLHPRSILGLLKAGYH--GVLRSRDPTG 111

  Fly   101 -RVLV---------VFKTVDGFQDYPDYLQSLVEMDDLIFESLLLLPRVQQNGITVICDLQGTNR 155
             |||:         ||...|.|:      .||: ..:||.:.:    ..|:||:..|.||:|...
  Rat   112 SRVLIYRISYWDPKVFTAYDVFR------VSLI-TSELIVQEV----ETQRNGVKAIFDLEGWQI 165

  Fly   156 NFLRQFSPAFMK----VVNEKNGVLPFSQRIVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDG 216
            :...|.:|:..|    ||.:.   .|...|.:|:|....:.|...::..||:.::.|.:|..|..
  Rat   166 SHAFQITPSVAKKIAAVVTDS---FPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKGRIHLHGN 227

  Fly   217 RHLSKLREMVGYESLPAEYGGPATNVLD-----TNLIF---NHLSQNAEYLE 260
            .:.|.|.:... :.||.||||..:::.|     ||.|.   ::||..:|.::
  Rat   228 NYKSSLLQHFP-DILPLEYGGNESSMEDICQEWTNFIMKSEDYLSSISETIQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 6/23 (26%)
CRAL_TRIO 92..237 CDD:279044 42/158 (27%)
TtpaNP_037180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
CRAL_TRIO_N 25..73 CDD:215024 6/23 (26%)
CRAL_TRIO 99..248 CDD:395525 45/165 (27%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.