DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and CG30339

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:290 Identity:65/290 - (22%)
Similarity:111/290 - (38%) Gaps:56/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTARVDHTAE-QIFKIEQ--------LRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIH 59
            |:|.:...|| ::.::|:        ||..:.|...||...:|..|..||...::...|....:.
  Fly     7 LSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEKTKSKLD 71

  Fly    60 DYYEFKRRHPTWVARHPIEHYRQLFY---GTHCRYVMPQADRSGRVLVV---------FKTVDGF 112
            .:|..|...|....:..::. |.|..   ||:.|...|......|:.:.         ||.:|.|
  Fly    72 HFYTIKTLMPELFGKRLVDE-RNLILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKEFKLLDLF 135

  Fly   113 QDYPDYLQSLVEMDDLIFESLLLLPRVQQNGITVICDLQGTNRNFLRQFSPAFMK---VVNEKNG 174
            :......:..:..||          ....:|...|.|:...:.:||.|.....:|   :..||  
  Fly   136 RYQTMITEQSIREDD----------HSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEK-- 188

  Fly   175 VLPFSQRIVHII---QRGF-LMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEY 235
            ..|...:.||:|   :.|. |:::..:|....:.:.|      |..::|.:|.|::..|.||.||
  Fly   189 AQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRF------HVYKNLEQLNEVIPREYLPEEY 247

  Fly   236 GGPATNVLDTNLIFNHLSQNAEYLEKLQTY 265
            ||....:.|.         .||..:||.:|
  Fly   248 GGNNGRIADI---------QAEAEKKLLSY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 11/51 (22%)
CRAL_TRIO 92..237 CDD:279044 34/160 (21%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 10/41 (24%)
CRAL_TRIO 109..250 CDD:279044 34/158 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.