DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and Clvs2

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_780657.1 Gene:Clvs2 / 215890 MGIID:2443223 Length:327 Species:Mus musculus


Alignment Length:250 Identity:52/250 - (20%)
Similarity:113/250 - (45%) Gaps:59/250 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IEQLRQLVEKCEDLR-VGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRH----PTWVARHP- 76
            |:::|.:|....|:. :.|:|..:.:||...::...:|::.:..|:|:::::    .::.|..| 
Mouse    31 IQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLAQYFEYRQQNLDMFKSFKATDPG 95

  Fly    77 ---------------IEHYRQLFYGTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMD 126
                           ::||.:                  ::||:|..        ::.||...:.
Mouse    96 IKQALKDGFPGGLANLDHYGR------------------KILVLFAA--------NWDQSRYTLV 134

  Fly   127 DLIFESLLLL------PRVQQNGITVICDLQGTNRNFLRQFSPAFMKVVNEKNGVL-PFSQRI-- 182
            |::...||.|      |.:|.||..:|.|..........:.:|..:::..|  |:. .|..|.  
Mouse   135 DILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPNMLRLAIE--GLQDSFPARFGG 197

  Fly   183 VHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGG 237
            :|.:.:.:.:|...|:..||:.::.:::||.| |.:|:.|.:::..|.||:|:||
Mouse   198 IHFVNQPWYIHALYTVIRPFLKEKTRKRIFLH-GNNLNSLHQLIHPEILPSEFGG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 9/43 (21%)
CRAL_TRIO 92..237 CDD:279044 35/153 (23%)
Clvs2NP_780657.1 CRAL_TRIO_N 29..75 CDD:215024 9/43 (21%)
SEC14 106..251 CDD:238099 37/173 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.