DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and C34C12.6

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_497717.2 Gene:C34C12.6 / 175452 WormBaseID:WBGene00007925 Length:400 Species:Caenorhabditis elegans


Alignment Length:312 Identity:62/312 - (19%)
Similarity:109/312 - (34%) Gaps:85/312 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DHTAEQIFKIEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRW------DTIKAYQAIHDYYEFKRR 67
            |....||..:..:.|  ||..|   |..|.:.|. |:..||      ||.|..:....|.. .|:
 Worm    15 DSERSQINSVRAMLQ--EKLPD---GIPDDVNTD-LNLCRWIRGYHGDTEKLVKNFATYLA-SRK 72

  Fly    68 HPTWVARHPIEHYRQL--------FYGTHCRYVMPQADRSGRVLVV-------------FKTVDG 111
            ...:|.....|.:.:|        |..:........:|.....|.|             |||   
 Worm    73 AAGFVGNDFAEKFFELPSIAPFLQFIASSRLQDRQWSDEHNAFLFVERAWSQPKEFIKTFKT--- 134

  Fly   112 FQDYPDYLQSLVEMDDLIFESLLLLPRVQQNG------ITVICDLQGTN-RNFLRQFSPAFMKVV 169
                .|||.......::: :.|:|....:|:.      ..||.||...| .:::...| .:||:.
 Worm   135 ----SDYLLHCFGYSEML-QQLILRREKKQSADKGPVQFIVIFDLNTVNITDYVNPMS-GYMKLW 193

  Fly   170 NEKNGVLPFSQRIVHIIQRGFLMHVTSTLFM------PFMNKEFKEKIFTHDGRHLSKLREMVGY 228
            ..::.:  :......::||.:|.:....|.:      .|:::|..::|            |::..
 Worm   194 QIRSEL--WQDWFPEMVQRIYLTNPPRLLGLLWKVARVFLSEENLKRI------------EIISD 244

  Fly   229 ES-----------LPAEYGGPATNVL----DTNLIFNHLSQNAEYLEKLQTY 265
            :|           :|.||||...|.:    :|.:.......:|:|.:..|.|
 Worm   245 KSDLAGKFLPPWLVPKEYGGEFVNTVPPGDETGVSVRRKITSADYYKPYQHY 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 13/49 (27%)
CRAL_TRIO 92..237 CDD:279044 32/181 (18%)
C34C12.6NP_497717.2 SEC14 91..265 CDD:214706 34/196 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.