DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and ctg-2

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001254156.1 Gene:ctg-2 / 174360 WormBaseID:WBGene00011756 Length:408 Species:Caenorhabditis elegans


Alignment Length:99 Identity:25/99 - (25%)
Similarity:45/99 - (45%) Gaps:7/99 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GITVICDLQGTNRNFLRQFSPAFMKVV----NEKNGVLPFSQRIVHIIQRGFLMHVTSTLFMPFM 203
            |.:||.||.|.:   :.|...|.:|||    ::...:.|...|.:.|:.....:.|..::..|.:
 Worm   169 GTSVIFDLDGLS---MVQIDLAALKVVTTMLSQLQEMFPDVIRKIFIVNTPTFIQVLWSMISPCL 230

  Fly   204 NKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGG 237
            .|:.::|:..........|:|.:|.|.|...:||
 Worm   231 AKQTQQKVKILGNDWKQHLKENIGEEVLFERWGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024
CRAL_TRIO 92..237 CDD:279044 23/97 (24%)
ctg-2NP_001254156.1 SEC14 98..267 CDD:214706 25/99 (25%)
EMP24_GP25L 331..>405 CDD:279450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.