DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and H41C03.1

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_495168.1 Gene:H41C03.1 / 173994 WormBaseID:WBGene00019268 Length:396 Species:Caenorhabditis elegans


Alignment Length:262 Identity:53/262 - (20%)
Similarity:102/262 - (38%) Gaps:58/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRW------DTIKAYQAIHDYYEFKRRHP-----TW 71
            ::.||   .:|:||.....||    ..:..||      |..:|...:..:..|::.:.     |.
 Worm     9 VDYLR---HECKDLLTEYYDT----DFNLLRWAQGYGFDKDEALAELRRHLRFRQYYDLDNILTN 66

  Fly    72 VARHPI-EHYRQLFYGTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMDDLI----FE 131
            |..||| :.|..|       .::.:..:..::||:  ...|..|....|:|:...|.||    |:
 Worm    67 VPDHPILKKYFPL-------GLVGETGKDNQLLVI--ECAGRIDLMGILKSVHLSDFLIQRFKFQ 122

  Fly   132 SLLLLPRVQ-------QNGITVICDLQGTNRNFLRQFSPAFMKVVNEKNGVLPFSQRIVH--IIQ 187
            ..:|....:       |..:..|.||:|.      :|.||.:.:|.....:|..|....:  .|.
 Worm   123 EKMLAAMNEMERKYGTQCSVIYILDLEGL------KFDPALISIVTGPYRILWASVYTAYPEWIN 181

  Fly   188 RGFLMHVTSTLFM------PFMNKEFKEKIFTHDGRH--LSKLREMVGYESLPAEYGGPATNVLD 244
            ..||::..|.:.:      |.:.:..:.|:....|..  .:.:::....:::|..:||   .::|
 Worm   182 TLFLINAPSFMTLLWKAIGPLLPERTRNKVRICSGNSDWKTSVQKHAHIDNIPKHWGG---TLVD 243

  Fly   245 TN 246
            .|
 Worm   244 KN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 11/48 (23%)
CRAL_TRIO 92..237 CDD:279044 30/165 (18%)
H41C03.1NP_495168.1 SEC14 69..242 CDD:214706 37/190 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.