DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and CLVS1

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_775790.1 Gene:CLVS1 / 157807 HGNCID:23139 Length:354 Species:Homo sapiens


Alignment Length:286 Identity:65/286 - (22%)
Similarity:122/286 - (42%) Gaps:72/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IEQLRQLVEKCEDLR-VGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHPTWVARHPIEHYR 81
            |:|:|.::....|:. :.|:|..:.:||...::....|::.:..|::                ||
Human    53 IQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQ----------------YR 101

  Fly    82 QL----------------------FYGTHCRYVMPQADRSGRVLVVFKTVDGFQ---DYPDYLQS 121
            ||                      |.|     |:...|..||.:::....:..|   .:.|.|::
Human   102 QLNLDMFKNFKADDPGIKRALIDGFPG-----VLENRDHYGRKILLLFAANWDQSRNSFTDILRA 161

  Fly   122 LVEMDDLIFESLLLLPRVQQNGITVICDLQGTNRNFLRQFSPAFMKVVNEKNGVL-PFSQRI--V 183
            ::    |..|.|:..|.:|.||..:|.|....:.....:.:|:.:|:..|  |:. .|..|.  |
Human   162 IL----LSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIE--GLQDSFPARFGGV 220

  Fly   184 HIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGP---------A 239
            |.:.:.:.:|...||..||:..:.:::||.| |.:|:.|.:::..|.||:|:||.         |
Human   221 HFVNQPWYIHALYTLIKPFLKDKTRKRIFLH-GNNLNSLHQLIHPEFLPSEFGGTLPPYDMGTWA 284

  Fly   240 TNVL-----DTNLIFNHLSQNAEYLE 260
            ..:|     |.| .:.|.|.||.:::
Human   285 RTLLGPDYSDEN-DYTHTSYNAMHVK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 9/43 (21%)
CRAL_TRIO 92..237 CDD:279044 39/150 (26%)
CLVS1NP_775790.1 CRAL_TRIO_N 51..97 CDD:215024 9/43 (21%)
CRAL_TRIO 125..274 CDD:306996 42/160 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.