DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and Sec14l2

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_446253.2 Gene:Sec14l2 / 116486 RGDID:621779 Length:403 Species:Rattus norvegicus


Alignment Length:262 Identity:59/262 - (22%)
Similarity:104/262 - (39%) Gaps:39/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTARV-DHTAEQIFKIEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRR 67
            ::.|| |.:.:|...:.:.|:.|:.........:|..|.::|....:|..|:...:..:.||:::
  Rat     1 MSGRVGDLSPKQEEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQ 65

  Fly    68 HP-----TWVARHPIEHYRQLFYGTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMDD 127
            ..     :|   .|.|..:|...|..|.|     |..|  ..|:..:.|..|....|.|..:.|.
  Rat    66 KDIDKIISW---QPPEVIQQYLSGGRCGY-----DLDG--CPVWYDIIGPLDAKGLLFSASKQDL 120

  Fly   128 LIFE----SLLLLPRVQQNG--------ITVICDLQGTNRNFLRQFSPA------FMKVVNEKNG 174
            |..:    .|||.....|..        ||:|.|.:|.....|  :.||      |:.:..|.  
  Rat   121 LRTKMRDCELLLQECTHQTAKLGKKIETITMIYDCEGLGLKHL--WKPAVEAYGEFLTMFEEN-- 181

  Fly   175 VLPFSQRIVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPA 239
             .|.:.:.:.:::...|..|...|..||::::.::||..........|.:.:..:.||.||||..
  Rat   182 -YPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQLPVEYGGTM 245

  Fly   240 TN 241
            |:
  Rat   246 TD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 7/43 (16%)
CRAL_TRIO 92..237 CDD:279044 36/162 (22%)
Sec14l2NP_446253.2 CRAL_TRIO_N 13..59 CDD:215024 7/45 (16%)
SEC14 76..244 CDD:214706 43/179 (24%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.