DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and Sec14l4

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_666125.1 Gene:Sec14l4 / 103655 MGIID:2144095 Length:403 Species:Mus musculus


Alignment Length:250 Identity:53/250 - (21%)
Similarity:101/250 - (40%) Gaps:43/250 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EQLRQLVEKCEDL---RVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHP-----TWVARH 75
            |.|.:..|..:||   ....:|..|.::|....:|..|:...:..:.||:.:..     ||.|..
Mouse    14 EALARFRETLQDLLPTLPKADDYFLLRWLRARNFDLKKSEDMLRKHVEFRNQQNLDQILTWQAPE 78

  Fly    76 PIEHYRQLFYGTHCRY----------VMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMDDLIF 130
            .|:.|..   |....|          ::...|..|..:...|        .|.::..:::.:::.
Mouse    79 VIQLYDS---GGLSGYDYEGCPVWFDIIGTMDPKGLFMSASK--------QDMIRKRIKVCEMLL 132

  Fly   131 ESLLLLPRVQQNG-----ITVICDLQGTNRNFLRQFSPAFMKVVNEKNGVL----PFSQRIVHII 186
            ....|  :.|:.|     :.::.|::|.:...|  :.|| ::|..:...:|    |.:.:.:.||
Mouse   133 HECEL--QSQKLGRKIERMVMVFDMEGLSLRHL--WKPA-VEVYQQFFAILEANYPETVKNLIII 192

  Fly   187 QRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPATN 241
            :...|..|...|...||.:|.::||....|....:|.:.|..:.||.|:||..|:
Mouse   193 RAPKLFPVAFNLVKSFMGEETQKKIVILGGNWKQELVKFVSPDQLPVEFGGTMTD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 10/44 (23%)
CRAL_TRIO 92..237 CDD:279044 31/153 (20%)
Sec14l4NP_666125.1 CRAL_TRIO_N 13..59 CDD:215024 10/44 (23%)
SEC14 77..244 CDD:214706 36/182 (20%)
GOLD_2 284..379 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.