DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31826 and sec14l3

DIOPT Version :9

Sequence 1:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001120265.1 Gene:sec14l3 / 100145318 XenbaseID:XB-GENE-951877 Length:410 Species:Xenopus tropicalis


Alignment Length:252 Identity:48/252 - (19%)
Similarity:97/252 - (38%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EQLRQLVEKCEDLR-----VGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHPT------WV 72
            |.|.:..|..:||.     ...:|..|.::|....::..||...:....||:::..:      | 
 Frog    14 EALVKFRENVKDLMPRLPPFSQDDYFLLRWLRARSFNLQKAENMLRKNVEFRKQMDSDNVLEKW- 77

  Fly    73 ARHPIEHYRQLFYGTHCRY----------VMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMDD 127
              .|.|..::...|..|.:          |:...|..|.:....|        .|.:::.:...:
 Frog    78 --QPPEVVQKYLSGGLCGHDREDSPIWYDVIGPLDPKGLLFSASK--------QDLMKTKMRDCE 132

  Fly   128 LI-----FESLLLLPRVQQNGITVICDLQGTNRNFLRQFSPA---FMKVVNEKNGVLPFSQRIVH 184
            ::     .:|..|..||:.  :.:|.|::|.....|  :.||   :.:::.......|.:.:.:.
 Frog   133 VLHHACRMQSEKLGKRVED--VVMIYDVEGLGLKHL--WKPAVELYGEILQMFEDNYPEALKRLF 193

  Fly   185 IIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPATN 241
            :|:...|..|...|...|::::.:.||..........|::.:..|.||..|||..|:
 Frog   194 VIKAPKLFPVAYNLIKHFLSEDTRRKIMVLGDNWQDVLKKYIAPEELPQYYGGTLTD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 10/46 (22%)
CRAL_TRIO 92..237 CDD:279044 28/152 (18%)
sec14l3NP_001120265.1 CRAL_TRIO_N 13..60 CDD:215024 10/45 (22%)
SEC14 79..248 CDD:214706 34/180 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.