DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31823 and PRC1

DIOPT Version :9

Sequence 1:NP_723939.1 Gene:CG31823 / 326163 FlyBaseID:FBgn0051823 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_014026.1 Gene:PRC1 / 855343 SGDID:S000004912 Length:532 Species:Saccharomyces cerevisiae


Alignment Length:430 Identity:107/430 - (24%)
Similarity:178/430 - (41%) Gaps:77/430 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VGLGPGVQEW-DYVEVR-KGAHLFYWLLYTTANVSHFIERPLVIWLQGGPGVASTGSGIFEQLGP 90
            :|:.|.|.:: .|::|. :..|.|:|   |..:.:...:.|:::||.||||.:|. :|:|.:|||
Yeast   119 LGIDPNVTQYTGYLDVEDEDKHFFFW---TFESRNDPAKDPVILWLNGGPGCSSL-TGLFFELGP 179

  Fly    91 I----DIEGKTRESSWLKHVNVLFVDSPVGTGFAYVEHHSLYARNNRQIALDLVQLMKQFLTKYP 151
            .    |::......||..:..|:|:|.||..||:|  ..|....|......|:...::.|..::|
Yeast   180 SSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSY--SGSSGVSNTVAAGKDVYNFLELFFDQFP 242

  Fly   152 DF--RKVPLHIFSESYGGKMAPEFALELHLAKKVGELECDLKSVVVGNPWTSPLDSILSYAPFLL 214
            ::  :....||..|||.|...|.||.|: |:.|  :...:|.||::||..|.||.....|.|...
Yeast   243 EYVNKGQDFHIAGESYAGHYIPVFASEI-LSHK--DRNFNLTSVLIGNGLTDPLTQYNYYEPMAC 304

  Fly   215 QSGIVDDDGYRRISRLAGELAALVYGGKWLRALMKATEVQDEISASAGGV-FIYNTQRRVHVDEV 278
            ..|              ||.:.|        ...:.:.::|.:....|.: ..|::|........
Yeast   305 GEG--------------GEPSVL--------PSEECSAMEDSLERCLGLIESCYDSQSVWSCVPA 347

  Fly   279 YRYGEDPQMSDFMRS-----NVTKALGLGNM--PVWMEQNSTV---------------FERLSQD 321
            ..|..:.|::.:.|:     ::.|....||:  |...:.:..:               :|..:.|
Yeast   348 TIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFD 412

  Fly   322 I----------FKPANQIVTKLL-EETPIQVGIYSGILDLLCATPGTVNWIRRLKWRRSLEYA-- 373
            |          .||.:..||.|| ::.||.|  |:|..|.:|...|...|...|.|:...|:|  
Yeast   413 INRNFLFAGDWMKPYHTAVTDLLNQDLPILV--YAGDKDFICNWLGNKAWTDVLPWKYDEEFASQ 475

  Fly   374 KAPRTAIRIEGMLEGYEKHGGKLSMFWVFRAGHLVQQENP 413
            |.......|...:.|..|.....:...||..||:|..:.|
Yeast   476 KVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVP 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31823NP_723939.1 Peptidase_S10 26..425 CDD:298660 107/430 (25%)
PRC1NP_014026.1 Kex1 25..528 CDD:225490 107/430 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2918
OMA 1 1.010 - - QHG54069
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9182
orthoMCL 1 0.900 - - OOG6_100109
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.670

Return to query results.
Submit another query.