DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31823 and scpl41

DIOPT Version :9

Sequence 1:NP_723939.1 Gene:CG31823 / 326163 FlyBaseID:FBgn0051823 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001318730.1 Gene:scpl41 / 834228 AraportID:AT5G42230 Length:469 Species:Arabidopsis thaliana


Alignment Length:434 Identity:101/434 - (23%)
Similarity:167/434 - (38%) Gaps:79/434 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VEVRKGAHLFYWLLYTTANVSHFIERPLVIWLQGGPGVASTGSGIFEQLGPIDIEG-----KTRE 99
            :::..|..|||   |......|...:||.:||.||||.:|.|.|.|.:|||....|     :...
plant    49 LDLNAGRSLFY---YFVEAEKHPDTKPLTLWLNGGPGCSSVGGGAFTELGPFYPTGYGRGLRINS 110

  Fly   100 SSWLKHVNVLFVDSPVGTGFAYVEHHSLYARNNRQIALDLVQLMKQFLTKYPDFRKVPLHIFSES 164
            .||.|..|:||||||.|.|::|....|.|...::..|.|::..:.::..|:|:.:...|.:..||
plant   111 MSWNKASNLLFVDSPAGVGWSYSNRSSDYNAGDKSAASDMLVFLLRWFDKFPELKSHDLFLTGES 175

  Fly   165 YGGKMAPEFA-LELHLAKKVGELECDLKSVVVGNPWTSPLDSILSYAPFLLQSGIVDD------- 221
            |.|...|:.| ..|....:....:.::|.:.:|||.......|.:...|....|::.:       
plant   176 YAGHYIPQLADAILSYNSRSSGFKFNIKGIAIGNPLLKLDRDIPAVYEFFWSHGMISEVVGRTIK 240

  Fly   222 -----------------DGYRRISRLAGELAA-----------LVYGGKWLRALMKATEVQDEIS 258
                             |......|.||::..           |.|....|:.| :..::..::|
plant   241 IQCDFSHYTYAYPHNVSDACNDAIREAGDITTEYVNTFDVLPDLCYPSIALQEL-RLKQMATKMS 304

  Fly   259 ASAGGVFIYNTQRRVHVDEVYRYGEDPQMSDFMRSNVTKALGLGNMPVWMEQNSTVFERLSQDIF 323
            ........|..|..:::.||       ||:  :.:|.|      |:|......|.:....:.|: 
plant   305 MGVDVCMNYERQFYLNIPEV-------QMA--LHANRT------NLPYSWSLCSNLLNYSAIDV- 353

  Fly   324 KPANQIVT-KLLEETPIQVGIYSGILDLLCATPGTVNWI----RRLKWRRSLEYA----KAPRTA 379
             ..|.:.| |.:.:..|.|.|:||..|.:....||...:    ..|.::.::.|.    |.....
plant   354 -NTNMLPTLKRIIQNKIPVRIFSGDQDSVVPFLGTRTIVGELANDLNFKTTVPYGVWFHKRQVGG 417

  Fly   380 IRIEGMLEGYEKHGGKLSMFWVFRAGHLVQQENPAAMAYILRYF 423
            ..||        :|..|:...|..|.|.|....|:...::...|
plant   418 WAIE--------YGNLLTFATVRGAAHAVAYTQPSRALHLFSTF 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31823NP_723939.1 Peptidase_S10 26..425 CDD:298660 101/434 (23%)
scpl41NP_001318730.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54069
OrthoDB 1 1.010 - - D625787at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.