DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31823 and scpl39

DIOPT Version :9

Sequence 1:NP_723939.1 Gene:CG31823 / 326163 FlyBaseID:FBgn0051823 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_190770.1 Gene:scpl39 / 824365 AraportID:AT3G52020 Length:501 Species:Arabidopsis thaliana


Alignment Length:433 Identity:105/433 - (24%)
Similarity:186/433 - (42%) Gaps:86/433 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YVEVRK--GAHLFYWLLYTTANVSHFIERPLVIWLQGGPGVASTGSGIFEQLGPIDI--EGK--- 96
            ||.|.:  |..|:|:.:..|......   |||:||.||||.:|. .|.|::|||..|  :||   
plant    97 YVTVNESAGRSLYYYFVEATKTKKSL---PLVLWLNGGPGCSSL-YGAFQELGPFRIYGDGKTLY 157

  Fly    97 TRESSWLKHVNVLFVDSPVGTGFAYVEHHS-LYARNNRQIALDLVQLMKQFLTKYPDFRKVPLHI 160
            |...||....|:||::|||||||:|....| |....:.:.|.|....:.::|.::|:::....:|
plant   158 TNPYSWNNVANILFLESPVGTGFSYTNTESDLENPGDMKAAADKYIFLVKWLERFPEYKGREFYI 222

  Fly   161 FSESYGGKMAPEFALELHLAKKVGELECDLKSVVVGNP-------WTSPLDSILSYAPFLLQSGI 218
            ..|||.|...|:.|..: |.....:...:|:.:::|||       .|...|.::|:| .|.|..:
plant   223 AGESYAGHYVPQLAQTI-LVHNKNQNFINLRGILIGNPTLNDIVETTGSFDYLVSHA-LLSQDSL 285

  Fly   219 VDDDGYRR-----ISRLAGELAALVYGGKWLRALMKATEVQDEISASAGGVFIYN---------- 268
            :   .|:.     ..::..:..||            :.::.|:|..    :.:||          
plant   286 L---SYKENCATDTPKMEVDCIAL------------SMKIDDDIKK----MNLYNILTPTCINAT 331

  Fly   269 ----TQRRVHVDEVYRYGEDPQMSDFM-----RSNVTKALGLGNMP-VWMEQN-STVFERLSQDI 322
                |.:......|.:|  :|....::     |.:|.:::.:..:| .||..| :|.|.....|.
plant   332 LTPLTNQSKECTTVLQY--EPCGMQYIAAYLNREDVQRSMHVTKLPHTWMLCNEATGFNWNQTDY 394

  Fly   323 FKPANQIVTKLLEETPIQVGIYSGILDLLCATPGTVNWIRRLKWRRSLEYAKAPRTAIR------ 381
            ......|:.:|::...::|.:|:|..|.:.....|::.::.:.           .||:.      
plant   395 SASMLPILKELMKHDQLRVWVYTGDTDTVIPLTVTMHALKMMN-----------LTAVTDWLPWF 448

  Fly   382 IEGMLEGY-EKHGGKLSMFWVFRAGHLVQQENPAAMAYILRYF 423
            .||.:.|: |::.|......|..|||.|....|.|...:.::|
plant   449 SEGQVGGFTEEYKGNFRYATVIGAGHEVPLYKPKAALTLFKHF 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31823NP_723939.1 Peptidase_S10 26..425 CDD:298660 105/433 (24%)
scpl39NP_190770.1 Peptidase_S10 84..494 CDD:278857 105/433 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54069
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.