DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31823 and scpl37

DIOPT Version :9

Sequence 1:NP_723939.1 Gene:CG31823 / 326163 FlyBaseID:FBgn0051823 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_190769.1 Gene:scpl37 / 824364 AraportID:AT3G52010 Length:487 Species:Arabidopsis thaliana


Alignment Length:428 Identity:119/428 - (27%)
Similarity:192/428 - (44%) Gaps:73/428 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YVEVRKGAHLFYWLLYTTA---NVSHFIERPLVIWLQGGPGVASTGSGIFEQLGPIDIEGKTRE- 99
            ||.|.:.:..|.:..:..|   |.|    .|||||..|||..:|.| |.|.:|||..:....|: 
plant    83 YVPVNEPSSRFLYYYFVEAIKPNTS----TPLVIWFNGGPACSSLG-GAFLELGPFRVHSGGRKL 142

  Fly   100 ----SSWLKHVNVLFVDSPVGTGFAY----VEHHSLYARNNRQIALDLVQLMKQFLTKYPDFRKV 156
                .||....||||::|||.|||:|    ::...|..:.::..|.|....:..:|.::|:::..
plant   143 FRNPYSWNNEANVLFLESPVTTGFSYSSNPIDLEELGEKGDKATAEDNYIFLMNWLERFPEYKGR 207

  Fly   157 PLHIFSESYGGKMAPEFA-LELHLAKKVGELECDLKSVVVGNPWTSPLDSILS-YA-PFLLQSGI 218
            .::|..:||.|...|:.| :.:|..||.   ..:|:.:::|||  |.|.||.. |. .|:|..|:
plant   208 DIYIAGQSYAGHYVPQLAQIIIHRNKKT---LVNLRGILIGNP--SLLTSIQDPYGYEFMLSHGL 267

  Fly   219 VDD---DGYRRISRLAGEL-----AALVYGGKWLRALMKATEVQDEISASAGGVFIYNTQRRVH- 274
            :..   |.|.:.. |..:|     .||.     ::.:..|.:..|..:..| .|.:.:|..|:. 
plant   268 MSQQQMDNYNQFC-LRDDLYDNDKCALS-----VKTIDDAKKHLDTYNIYA-PVCLNSTLSRISK 325

  Fly   275 ----VDEVYRYGEDPQMSDFM-----RSNVTKALGLGNMPV---WMEQNSTVFERLSQ-DIFKPA 326
                |.||     ||...|::     |..|.||:......:   |...|:.:.|..|: |...|.
plant   326 KCTTVLEV-----DPCSKDYLKAYLNRKKVQKAIHANTTKLPYEWTSCNNELTENWSENDRDTPM 385

  Fly   327 NQIVTKLLEETPIQVGIYSGILDLLCATPGTVNWIRRLKWRRSLEYAKAPR---TAIRIEGMLEG 388
            ..|:.:|:.| .::|.||:|.:||......|:..::.:    :|...|..|   |..::.|..|.
plant   386 IPILHELMGE-GVRVMIYNGDVDLEIPFASTLAVVKEM----NLTVVKEFRPWFTGGQLGGFTED 445

  Fly   389 YEKHGGKLSMFWVFRAGHLVQQENPAAMAYILRYFTSY 426
            |:   |.|:...|..|||.|..:.|   .:.|..|||:
plant   446 YK---GNLTFVTVKGAGHSVPTDQP---IHALNIFTSF 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31823NP_723939.1 Peptidase_S10 26..425 CDD:298660 117/425 (28%)
scpl37NP_190769.1 Peptidase_S10 69..480 CDD:278857 119/428 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54069
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.