DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31823 and scpl36

DIOPT Version :9

Sequence 1:NP_723939.1 Gene:CG31823 / 326163 FlyBaseID:FBgn0051823 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_190768.1 Gene:scpl36 / 824363 AraportID:AT3G52000 Length:482 Species:Arabidopsis thaliana


Alignment Length:455 Identity:108/455 - (23%)
Similarity:181/455 - (39%) Gaps:131/455 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YVEVRK--GAHLFYWLLYT--TANVSHFIERPLVIWLQGGPGVASTGSGIFEQLGPIDI--EGKT 97
            ||.|.|  |..|:|:.:.|  ..|.:     |||||..||||.:|.| |.|::|||..:  :|||
plant    82 YVAVNKPAGRFLYYYFVETIKPGNTT-----PLVIWFNGGPGCSSLG-GAFKELGPFRVHSDGKT 140

  Fly    98 ---RESSWLKHVNVLFVDSPVGTGFAYVEHHSLYARNNRQIALDLVQLMKQFLTKYPDFRKVPLH 159
               ...||....||||:::||||||:|........:.::..|.|....:..:|.::|:::...::
plant   141 LFRNPYSWNNEANVLFLETPVGTGFSYSNSPINGKQGDKATAEDNYMFLVNWLERFPEYKGRDIY 205

  Fly   160 IFSESYGGKMAPEFA-LELHLAKKVGELECDLKSVVVGNP-WTSPLDSILSYAPFLLQSGIVDD- 221
            |..:||.|...|:.| :.||   :..:...:|:.:::||| ....:.....| .|:...|::.. 
plant   206 IAGQSYAGHYVPQLAQIILH---RNNQTLINLRGILIGNPSLNREIQDDFGY-KFMFSHGLISQQ 266

  Fly   222 --DGYRRI--------------------------------------SRLAGE-------LAALVY 239
              |.|.:.                                      |.|:.|       :.|...
plant   267 QMDNYNKFCTDSDLYDWDKCHLASQKIEAQKTHLDIYNIYAPLCLNSTLSSEPKKCTTIMKADPC 331

  Fly   240 GGKWLRALMKATEVQDEISASAGGVFIYNTQRRVHVDEVYRYGEDPQMSDFMRSNVTKALGLGNM 304
            .|.:|:|.:...|||:.|.|                                  |.||      :
plant   332 SGNYLKAYLNIKEVQEAIHA----------------------------------NTTK------I 356

  Fly   305 PV-WMEQNS-TVFERLSQDIFKPANQIVTKLLEETPIQVGIYSGILDLLCATPGTVNWIRRL--- 364
            |. |...|: .::|...:|.:.....|:.:|:.: .::|.:|:|.:||:.....|:..::.:   
plant   357 PYEWTSCNTKLLWEWNEKDRYVSLTPILQELMGK-GVRVMLYNGDVDLVIPFTSTLAVVKTMNLT 420

  Fly   365 ---KWRRSLEYAKAPRTAIRIEGMLEGYEKHGGKLSMFWVFRAGHLVQQENPAAMAYILRYFTSY 426
               :||...       |...:.|..|.|:   |.|:...|..|||.|..:.|   .:.|..|||:
plant   421 VVKEWRPWF-------TGGHVGGFTEDYK---GNLTFVTVKGAGHSVPTDQP---IHALNIFTSF 472

  Fly   427  426
            plant   473  472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31823NP_723939.1 Peptidase_S10 26..425 CDD:298660 106/452 (23%)
scpl36NP_190768.1 Kex1 16..473 CDD:225490 108/455 (24%)
Peptidase_S10 68..475 CDD:278857 108/455 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54069
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.