DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31823 and Cpvl

DIOPT Version :9

Sequence 1:NP_723939.1 Gene:CG31823 / 326163 FlyBaseID:FBgn0051823 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_006506676.1 Gene:Cpvl / 71287 MGIID:1918537 Length:484 Species:Mus musculus


Alignment Length:424 Identity:111/424 - (26%)
Similarity:193/424 - (45%) Gaps:40/424 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLSLICVQGRVGLG---------PGVQEWDY-----VEVRKGAHLFYWLLYTTANVSHFIERPLV 68
            |||.....|::..|         ||:.:..|     |.....::||:|.........   :.|:|
Mouse    52 FLSPYIKNGKIKEGQRKSMVSPFPGMNDKSYAGYITVNQTYNSNLFFWFFPARMQPE---DAPVV 113

  Fly    69 IWLQGGPGVASTGSGIFEQLGPIDIEGK----TRESSWLKHVNVLFVDSPVGTGFAYVEHHSLYA 129
            :||||||| .|:..|:|.:.||..|...    .|:..|...:::|::|:||||||::.:|...||
Mouse   114 LWLQGGPG-GSSMFGLFVEHGPYIITSNMTVVARDFPWTFTLSMLYIDNPVGTGFSFTDHFQGYA 177

  Fly   130 RNNRQIALDLVQLMKQFLTKYPDFRKVPLHIFSESYGGKMAPEFALELHLAKKVGELECDLKSVV 194
            .:...:|.||...:.||.|.:|::.|...::..|||.||..|..|..:|....|.:.:..||.:.
Mouse   178 TSEDDVAQDLYSALIQFFTLFPEYAKNDFYVTGESYAGKYVPALAHYIHSLNPVRKFKIRLKGIA 242

  Fly   195 VGNPWTSPLDSILSYAPFLLQSGIVDDDGYRRISRLAGELAALVYGGKWLRALMKATEVQDEI-- 257
            :|:.:|.|...|..||.||.:.|::|:...:...:...:....:...:|    |||.|:.|::  
Mouse   243 IGDAYTDPESIIGGYAAFLYEIGLLDEQQQKYFQKQCSKCVKYIKEQEW----MKAFEILDKLLD 303

  Fly   258 -SASAGGVFIYNTQRRVHVDEVYRYGEDPQMSDFMR----SNVTKALGLGNMPVWMEQNSTVFER 317
             ..:.|..|..|.....:...:.:..|..:.|.|.:    ..|.:|:.:||..  ....:.|.:.
Mouse   304 GDVTTGSSFFQNVTGCTNYYNILQCTEPKEQSYFAKFLTLPQVRQAIHVGNQN--FSDGAEVEKH 366

  Fly   318 LSQDIFKPANQIVTKLLEETPIQVGIYSGILDLLCATPGTVNWIRRLKWRRSLEYAKAPRTAIRI 382
            |.:|..|.....:::::..  .:|.||:|.||::.|...|...:..:.|:.|..|.:|.|...:|
Mouse   367 LREDTVKSVKPWLSEIMNY--YKVLIYNGQLDIIVAAALTERSLMAMDWKGSRAYRRARRKVWKI 429

  Fly   383 ---EGMLEGYEKHGGKLSMFWVFRAGHLVQQENP 413
               :..:.||.:..||.....|...||::..:.|
Mouse   430 FKSDNEVAGYVRRVGKFHQVIVRGGGHILPYDQP 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31823NP_723939.1 Peptidase_S10 26..425 CDD:298660 108/416 (26%)
CpvlXP_006506676.1 Peptidase_S10 78..474 CDD:366108 104/398 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2918
OMA 1 1.010 - - QHG54069
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100109
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.670

Return to query results.
Submit another query.