DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31823 and Y67A10A.11

DIOPT Version :9

Sequence 1:NP_723939.1 Gene:CG31823 / 326163 FlyBaseID:FBgn0051823 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001076741.1 Gene:Y67A10A.11 / 4927036 WormBaseID:WBGene00044906 Length:292 Species:Caenorhabditis elegans


Alignment Length:48 Identity:12/48 - (25%)
Similarity:22/48 - (45%) Gaps:4/48 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VASTGSGIFEQLGPIDIEGKTRESSWLKHVNVLFVDSPVGTGFAYVEH 124
            :|:.|......:|.||..|..|:|.    :.|....|.||:...::::
 Worm   219 LATDGEQAQGSIGYIDTSGTCRQSD----ITVTDGASAVGSNGQFLKY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31823NP_723939.1 Peptidase_S10 26..425 CDD:298660 12/48 (25%)
Y67A10A.11NP_001076741.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.