DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31823 and Ctsa

DIOPT Version :9

Sequence 1:NP_723939.1 Gene:CG31823 / 326163 FlyBaseID:FBgn0051823 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001011959.2 Gene:Ctsa / 296370 RGDID:1309070 Length:493 Species:Rattus norvegicus


Alignment Length:466 Identity:108/466 - (23%)
Similarity:188/466 - (40%) Gaps:109/466 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CVQGRVGLGPGVQEWD-YVEVRKGAHLFYWLLYTTANVSHFIE-------RPLVIWLQGGPGVAS 79
            |:.| :...|..:::. |::.....|..||          |:|       .|:|:||.||||.:|
  Rat    50 CLPG-LAKQPSFRQYSGYLKASDSKHFHYW----------FVESQNDPKNSPVVLWLNGGPGCSS 103

  Fly    80 TGSGIFEQLGP--IDIEGKTRE---SSWLKHVNVLFVDSPVGTGFAYVEHHSLYARNNRQIALDL 139
            . .|:..:.||  |..:|.|.|   .||....|:|:::||.|.||:|.: ..:|..|:.::|.:.
  Rat   104 L-DGLLTEHGPFLIQPDGVTLEYNPYSWNLIANMLYIESPAGVGFSYSD-DKMYVTNDTEVAENN 166

  Fly   140 VQLMKQFLTKYPDFRKVPLHIFSESYGGKMAPEFALELHLAKKVGELECDLKSVVVGNPWTSPLD 204
            .|.:|.|...:|:::...|.:..|||.|...|..|:.:     :.:...:|:.:.|||..:|...
  Rat   167 YQALKDFYHLFPEYKDNKLFLTGESYAGIYIPTLAVLV-----MQDPSMNLQGLAVGNGLSSYEQ 226

  Fly   205 SILSYAPFLLQSGIV------------------------DDD---GYRRISRLAGELAALVY--- 239
            :..|...|....|::                        |.|   ..:.:||:.|:....:|   
  Rat   227 NDNSLVYFAYYHGLLGNRLWTSLQTHCCSQNKCNFYDNKDPDCVNNLQEVSRIVGKSGLNIYNLY 291

  Fly   240 ----GGKWLRALMKATEVQDEISASAGGVFI-YNTQRRVHVDEVYRYGE----DPQMSDFMRSN- 294
                ||...|...:.|.|..:.    |.:|. ...:||.....:.|.|:    ||..::....: 
  Rat   292 APCAGGVPGRDRSEDTLVVQDF----GNIFTRLPLKRRFPEALLLRSGDKVRLDPPCTNTTAPST 352

  Fly   295 ------VTKALGL-GNMPVWMEQNSTV---FERLSQDIFKPANQIVTKLLEETPIQVGIYSGILD 349
                  |.|||.: .::|.|...|..|   :.||    ::..|....|||.....|:.:|:|.:|
  Rat   353 YLNNPYVRKALHIPESLPRWDMCNLMVNLQYRRL----YESMNSQYLKLLSSQKYQILLYNGDVD 413

  Fly   350 LLCATPGTVNW----------IRRLKWRRSLEYAKAPRTAIRIEGMLEGYEKHGGKLSMFWVFRA 404
            :.|...|. .|          ::|..|  .::|.::..       .:.|:.|....::...:..|
  Rat   414 MACNFMGD-EWFVDSLNQKMEVQRRPW--LVDYGESGE-------QVAGFVKECSHITFLTIKGA 468

  Fly   405 GHLVQQENPAA 415
            ||:|..:.|.|
  Rat   469 GHMVPTDKPRA 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31823NP_723939.1 Peptidase_S10 26..425 CDD:298660 107/463 (23%)
CtsaNP_001011959.2 Peptidase_S10 52..489 CDD:278857 107/464 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100109
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.