DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31823 and Ctsa

DIOPT Version :9

Sequence 1:NP_723939.1 Gene:CG31823 / 326163 FlyBaseID:FBgn0051823 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_032932.2 Gene:Ctsa / 19025 MGIID:97748 Length:492 Species:Mus musculus


Alignment Length:465 Identity:106/465 - (22%)
Similarity:187/465 - (40%) Gaps:108/465 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CVQGRVGLGPGVQEWD-YVEVRKGAHLFYWLLYTTANVSHFIE-------RPLVIWLQGGPGVAS 79
            |:.| :...|..:::. |:......|..||          |:|       .|:|:||.||||.:|
Mouse    50 CLPG-LAKQPSFRQYSGYLRASDSKHFHYW----------FVESQNDPKNSPVVLWLNGGPGCSS 103

  Fly    80 TGSGIFEQLGP--IDIEGKTRE---SSWLKHVNVLFVDSPVGTGFAYVEHHSLYARNNRQIALDL 139
            . .|:..:.||  |..:|.|.|   .:|....|||:::||.|.||:|.: ..:|..|:.::|.:.
Mouse   104 L-DGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSD-DKMYVTNDTEVAENN 166

  Fly   140 VQLMKQFLTKYPDFRKVPLHIFSESYGGKMAPEFALELHLAKKVGELECDLKSVVVGNPWTSPLD 204
            .:.:|.|...:|:::...|.:..|||.|...|..|:.:     :.:...:|:.:.|||...|...
Mouse   167 YEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLV-----MQDPSMNLQGLAVGNGLASYEQ 226

  Fly   205 SILSYAPFLLQSGIVDD---------------------------DGYRRISRLAGELAALVY--- 239
            :..|...|....|::.:                           :....:||:.|:....:|   
Mouse   227 NDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLY 291

  Fly   240 ----GGKWLRALMKATEVQDEISASAGGVFIYNTQRRVHVDEVYRYGE----DPQM------SDF 290
                ||...|...:.|.|..:.    |.:|.....:|...:.:.|.|:    ||..      |::
Mouse   292 APCAGGVPGRHRYEDTLVVQDF----GNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNY 352

  Fly   291 MRS-NVTKALGL-GNMPVWMEQNSTV---FERLSQDIFKPANQIVTKLLEETPIQVGIYSGILDL 350
            :.: .|.|||.: .::|.|...|..|   :.||.|.:    |....|||.....|:.:|:|.:|:
Mouse   353 LNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSM----NSQYLKLLSSQKYQILLYNGDVDM 413

  Fly   351 LCATPGTVNW----------IRRLKWRRSLEYAKAPRTAIRIEGMLEGYEKHGGKLSMFWVFRAG 405
            .|...|. .|          ::|..|  .::|.::..       .:.|:.|....::...:..||
Mouse   414 ACNFMGD-EWFVDSLNQKMEVQRRPW--LVDYGESGE-------QVAGFVKECSHITFLTIKGAG 468

  Fly   406 HLVQQENPAA 415
            |:|..:.|.|
Mouse   469 HMVPTDKPRA 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31823NP_723939.1 Peptidase_S10 26..425 CDD:298660 105/462 (23%)
CtsaNP_032932.2 Peptidase_S10 52..488 CDD:366108 105/463 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100109
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.