DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31823 and F22E12.1

DIOPT Version :9

Sequence 1:NP_723939.1 Gene:CG31823 / 326163 FlyBaseID:FBgn0051823 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:127 Identity:30/127 - (23%)
Similarity:45/127 - (35%) Gaps:36/127 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 TQRRVHVDEVYRYGEDPQMSDFMRSNVTKALGLGNMPVWM-------EQNS-TVFERLSQDIFKP 325
            ||||:              .|.||.|..:.......||.|       :||| :|.|....::   
 Worm   359 TQRRI--------------QDTMRRNYFEQARYQRPPVQMPPPPPPPQQNSPSVNENYHPEL--- 406

  Fly   326 ANQIVTKLLE-----ETPIQVGIYSGILDLL-----CATPGTVNWIR-RLKWRRSLEYAKAP 376
            .||..:.|.|     ...::......|:.|:     ...|...|.:| |:||....:.|:.|
 Worm   407 VNQFKSHLDEHEKALRRKLEAQFPDHIITLIPHIETVRNPDGSNVVRQRIKWTAYPKGARIP 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31823NP_723939.1 Peptidase_S10 26..425 CDD:298660 30/127 (24%)
F22E12.1NP_505684.2 KU 25..76 CDD:238057
KU 85..138 CDD:238057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.