DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31823 and ctsa-4.2

DIOPT Version :9

Sequence 1:NP_723939.1 Gene:CG31823 / 326163 FlyBaseID:FBgn0051823 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_498460.1 Gene:ctsa-4.2 / 175938 WormBaseID:WBGene00021503 Length:512 Species:Caenorhabditis elegans


Alignment Length:388 Identity:84/388 - (21%)
Similarity:150/388 - (38%) Gaps:106/388 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YVEVRKGAHLFYWLLYTTANVSHFIERPLVIWLQGGPGVASTGSGIFEQLGPIDIEGKTRES--- 100
            |:.:.....||||.:.:..:..   ..|:|:||.||||.||. .|:|.::||..:.....|.   
 Worm    40 YLSISDVKQLFYWYVESEESPE---TAPVVLWLNGGPGCASM-EGLFIEMGPFRVRNYGEEVNRN 100

  Fly   101 --SWLKHVNVLFVDSPVGTGFAYVEHHSLYARNNR-----QIALDLVQLMKQFLTKYPDFRKVPL 158
              :|.:..|::::|:|.|.||:|      |....:     ::|.|....:|.:..::|:.:....
 Worm   101 PWTWNRIANIIYLDAPAGVGFSY------YNTTKKVFTDDEVAQDNFNALKMWFARFPERKTNDF 159

  Fly   159 HIFSESYGGKMAPEFALELHLAKKVGELECD---LKSVVVGNPWTSPLDSILSYAPFLLQSGIVD 220
            :|..|||||...|      .|:.::.:...|   .|.::|||                   |.||
 Worm   160 YIAGESYGGTYVP------MLSARITKANVDFPQFKGMLVGN-------------------GCVD 199

  Fly   221 DDGYRRISRLAGELAALVYGGKWLRALMKATEVQDEISASAGGVF--IYNTQRRVH------VDE 277
            |.        ......::|  ::..|::..|::|:.......|..  .|.|..:.:      |::
 Worm   200 DQ--------INFNTNIMY--QYYHAVVDETQMQNVTQQCCNGTMDCDYYTISQGNDTCGDLVNQ 254

  Fly   278 ----VYRYGEDPQMSDFMRSNVTKALGLG-NMPVWMEQNSTVFERLSQDIFKPANQIVTKLLEET 337
                :|..|.||....|       |..|. |:|....:.   ..:|.:::.:  |.:..|::.|:
 Worm   255 LSYSIYYTGYDPYFLYF-------ACYLNPNLPYPPHEE---IRKLQKNVLR--NNLYKKIIGES 307

  Fly   338 PIQVGIY--------SGILDLLCATPGTVNWIRRLKWRRSLEYAKAP--RTAIRIEGMLEGYE 390
            |:....|        .|..|  ||:...           ...|..:|  :.|:||...:..||
 Worm   308 PVLKNKYFYPPSNDIQGQPD--CASHDD-----------HFPYLNSPEVKKALRIPDYVPKYE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31823NP_723939.1 Peptidase_S10 26..425 CDD:298660 84/388 (22%)
ctsa-4.2NP_498460.1 Peptidase_S10 26..474 CDD:278857 84/388 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2918
OMA 1 1.010 - - QHG54069
OrthoDB 1 1.010 - - D625787at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100109
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.680

Return to query results.
Submit another query.