DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31793 and YKR104W

DIOPT Version :9

Sequence 1:NP_609930.4 Gene:CG31793 / 326161 FlyBaseID:FBgn0051793 Length:1307 Species:Drosophila melanogaster
Sequence 2:NP_013030.1 Gene:YKR104W / 853979 SGDID:S000001812 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:313 Identity:137/313 - (43%)
Similarity:198/313 - (63%) Gaps:29/313 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1013 MTSVERVLEYKDLDPEGDFNSPAEKQPPKSWPKEGKLVTKDLSLRYEPDTNSPCVLKGLSFTIQP 1077
            |:||||:.||.|:..|    |.....||.:||:.|.:..|:|||||.|  :|...|..:||.::.
Yeast     1 MSSVERIKEYTDIPSE----SNGYISPPANWPQTGDVELKNLSLRYSP--HSSKALDNVSFKVKA 59

  Fly  1078 MEKVGIVGRTGAGKSSLINALFRLS-YNDGAILIDSLDTNDIGLHDLRSKISIIPQEPVLFSGTM 1141
            ..||||||||||||||:|.|::||| :.:|.|.||:.|...|.|..||:.||.|||:|.||.||:
Yeast    60 GTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTV 124

  Fly  1142 RYNLDPFEQYPDDKLWKALEDVHLKEEISEL--------PS-----------GLQSIISEGGTNF 1187
            |.|||||::|.|.:::..|..|.|.||..||        |:           .|.:::..||:|.
Yeast   125 RSNLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRFIDLNTVVKSGGSNL 189

  Fly  1188 SVGQRQLVCLARAILRENRILVMDEATANVDPQTDALIQATIRNKFKDCTVLTIAHRLNTIMDSD 1252
            |.|||||:||||::|....|:::|||||::|..:||.||.|||...|:.|:|||||||.:::|.|
Yeast   190 SQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMKNTTILTIAHRLRSVIDYD 254

  Fly  1253 KVLVMDAGHVVEFGSPYELLTASKAKVFHGMVMQTGKASFDHLLKVAENTKQN 1305
            |:|||:.|.|.|:..||.|: :.:..:|:.:..|:|:  |::|.::|:.:..|
Yeast   255 KILVMEMGRVKEYDHPYTLI-SDRNTIFYRLCRQSGE--FENLFELAKVSFDN 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31793NP_609930.4 CFTR_protein 1..1273 CDD:273530 130/279 (47%)
ABC_membrane 112..364 CDD:294371
ABCC_MRP_domain1 434..632 CDD:213217
ABC_membrane 736..955 CDD:294371
ABCC_MRP_domain2 1047..1268 CDD:213211 113/240 (47%)
YKR104WNP_013030.1 ABCC_NFT1 27..270 CDD:213269 115/244 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.