DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31793 and Tap1

DIOPT Version :9

Sequence 1:NP_609930.4 Gene:CG31793 / 326161 FlyBaseID:FBgn0051793 Length:1307 Species:Drosophila melanogaster
Sequence 2:NP_114444.2 Gene:Tap1 / 24811 RGDID:3817 Length:725 Species:Rattus norvegicus


Alignment Length:603 Identity:146/603 - (24%)
Similarity:252/603 - (41%) Gaps:102/603 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   733 LVFVVLIMLCIGTQILASGGDYF---LSYWV--KNTASSSTLDIYYFTAINVGLVICALLRTLL- 791
            ||.|:||:.|:|...:    .:|   ::.|:  ..||.|...:::.       :.|..:..|.| 
  Rat   166 LVLVLLILSCLGEMAI----PFFTGRITDWILQDKTAPSFARNMWL-------MCILTVASTALE 219

  Fly   792 -----FFNITM-HSSTELHNTMFQGLSRTALYFFHTNPSGRILNRFANDLGQVDEVMPAVMLDCI 850
                 .:|||| |..:.:|..:|:.:......||..||:|.|.:|...|...|.|.:.    |.:
  Rat   220 FAGDGIYNITMGHMHSRVHGEVFRAVLHQETGFFLKNPTGSITSRVTEDTSNVCESIS----DKL 280

  Fly   851 QIFLTLTGIICVLCVTNPWYLINTFAMMLAFYYWRDFYLKT---------------------SRD 894
            .:||              ||| .....:|||..|..|||..                     |..
  Rat   281 NLFL--------------WYL-GRGLCLLAFMIWGSFYLTVVTLLSLPLLFLLPRRLGKVYQSLA 330

  Fly   895 VKRLEAVARSPMYSHFSATLVGLPTIRAM----GAQQTLIGQYDNYQDLHSS---GYYTFVSTSR 952
            ||..|::|:|...:  ...|..:||:|:.    |..|....:.:..:.|:..   .|.|.|.|..
  Rat   331 VKVQESLAKSTQVA--LEALSAMPTVRSFANEEGEAQKFRQKLEEMKPLNKKEALAYVTEVWTMS 393

  Fly   953 AFGYYLDLFCVAYVISVILHNFFNPPLHNAGQIGLAITQALGMTGMVQWGMRQSAELENAMTSVE 1017
            ..|..|.:..:.....:::....     ::|.:...:...|..|..|:..:.....::.::.:.|
  Rat   394 VSGMLLKVGILYLGGQLVVRGAV-----SSGNLVSFVLYQLQFTRAVEVLLSIYPSMQKSVGASE 453

  Fly  1018 RVLEYKDLDPEGDFNSPAEKQPPKSWPKEGKLVTKDLSLRYEPDTNSPCVLKGLSFTIQPMEKVG 1082
            ::.||.|..|....:........|     |.:..:|:|..| |:..:..||:||:||:.|.:...
  Rat   454 KIFEYLDRTPCSPLSGSLAPLNMK-----GLVKFQDVSFAY-PNHPNVQVLQGLTFTLYPGKVTA 512

  Fly  1083 IVGRTGAGKSSLINALFRLSY--NDGAILIDSLDTNDIGLHDLRSKISIIPQEPVLFSGTMRYNL 1145
            :||..|:|||: :.||.:..|  ..|.:|:|.........|.|.::::.:.|||:||..:.|.|:
  Rat   513 LVGPNGSGKST-VAALLQNLYQPTGGKVLLDGELLVQYDHHYLHTQVAAVGQEPLLFGRSFRENI 576

  Fly  1146 -------DPFEQYPDDKLWKALEDVHLKEEISELPSGLQSIISEGGTNFSVGQRQLVCLARAILR 1203
                   ...|:.....:.....|.     ||..|.|..:.:.|.|...|.||||.|.||||::|
  Rat   577 AYGLTRTPTMEEITAVAMESGAHDF-----ISGFPQGYDTEVGETGNQLSGGQRQAVALARALIR 636

  Fly  1204 ENRILVMDEATANVDPQTDALIQATIRN--KFKDCTVLTIAHRLNTIMDSDKVLVMDAGHVVEFG 1266
            :.|:|::|:||:.:|......:|..:..  ::...|||.|..:|:....:..:|.:..|.|.|.|
  Rat   637 KPRLLILDDATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQG 701

  Fly  1267 SPYELLTASKAKVFHGMV 1284
            :..:|:  .:...:..||
  Rat   702 THLQLM--ERGGCYRSMV 717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31793NP_609930.4 CFTR_protein 1..1273 CDD:273530 144/590 (24%)
ABC_membrane 112..364 CDD:294371
ABCC_MRP_domain1 434..632 CDD:213217
ABC_membrane 736..955 CDD:294371 60/258 (23%)
ABCC_MRP_domain2 1047..1268 CDD:213211 69/231 (30%)
Tap1NP_114444.2 3a01208 2..717 CDD:273363 144/601 (24%)
ABC_membrane 177..435 CDD:279056 61/294 (21%)
Part of the peptide-binding site. /evidence=ECO:0000250|UniProtKB:Q03518 352..397 10/44 (23%)
Part of the peptide-binding site. /evidence=ECO:0000250|UniProtKB:Q03518 430..464 6/33 (18%)
P-loop_NTPase 469..697 CDD:304359 67/239 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.