DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31793 and LOC110439293

DIOPT Version :9

Sequence 1:NP_609930.4 Gene:CG31793 / 326161 FlyBaseID:FBgn0051793 Length:1307 Species:Drosophila melanogaster
Sequence 2:XP_021330365.1 Gene:LOC110439293 / 110439293 -ID:- Length:174 Species:Danio rerio


Alignment Length:114 Identity:25/114 - (21%)
Similarity:49/114 - (42%) Gaps:20/114 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 RVAVSSAIYRK-ALRLSRTSLGGTTTGQVVNLLSNDLNRFDRCLIHFHFLWLGP----LELLIAS 225
            |:::||....| .|.|...|.|...|..::.....|:..      |..|| |.|    |.:::|.
Zfish    62 RISISSLCCAKTGLALCLASFGFLETVYLLVERRRDIEH------HMVFL-LSPIIRSLTMILAM 119

  Fly   226 YFLY-EQI-GMAS------FYGISILVLYLPLQTYLSRVTSKLRLQTAL 266
            ..:: |:: |..|      |:.::::...:||:..:..:..::...|.|
Zfish   120 LMIHLERLRGFRSSMFLFLFWMLAVVCSLVPLRANIQAIIEEVCTSTLL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31793NP_609930.4 CFTR_protein 1..1273 CDD:273530 25/114 (22%)
ABC_membrane 112..364 CDD:294371 25/114 (22%)
ABCC_MRP_domain1 434..632 CDD:213217
ABC_membrane 736..955 CDD:294371
ABCC_MRP_domain2 1047..1268 CDD:213211
LOC110439293XP_021330365.1 SunT 5..>161 CDD:331423 23/105 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.