DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaD and Snmp1

DIOPT Version :9

Sequence 1:NP_724087.1 Gene:ninaD / 326160 FlyBaseID:FBgn0002939 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001262803.1 Gene:Snmp1 / 42514 FlyBaseID:FBgn0260004 Length:551 Species:Drosophila melanogaster


Alignment Length:534 Identity:145/534 - (27%)
Similarity:226/534 - (42%) Gaps:70/534 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VFGLGTFFAVSGLLAIICWPGFIDSGIMKALPLTPTSKTFEKWEELPIPVYVYMYLWNWTNAADV 79
            :.|.|..|..:.:...:.:|..:...|.|.:.|.|.|...|.|...|.|::.|:|::|.||..:|
  Fly     9 LMGSGAMFVFAIIYGWVIFPKILKFMISKQVTLKPGSDVRELWSNTPFPLHFYIYVFNVTNPDEV 73

  Fly    80 QANGVKPIFAQLGPYVYREERKKMDLEWHDN---GTVTFNPRRTWFW----------EEE----- 126
             :.|.||...::||:|:.|.:.|.|||  |:   .||:|..|.|:.:          |||     
  Fly    74 -SEGAKPRLQEVGPFVFDEWKDKYDLE--DDVVEDTVSFTMRNTFIFNPKESLPLTGEEEIILPH 135

  Fly   127 ---LSGG--KQTDLITAPHLPSLAASNQMRNSNVFL--KFM--FNEALNANGGHLFVTHTAAEWL 182
               |.||  .|.:......|.|...|....::..||  |||  |...:|.:...   ...:|:.|
  Fly   136 PIMLPGGISVQREKAAMMELVSKGLSIVFPDAKAFLKAKFMDLFFRGINVDCSS---EEFSAKAL 197

  Fly   183 FESFYDEFLHYAMTLNNPLVPKIESDHFAW-FLNRNGSKDFEGPFTVHTGVGDIKEMGE-IKYWK 245
            ...||...:..|..:|        ..||.: |:.:....| .|.|||..||.:.|::|: :|:..
  Fly   198 CTVFYTGEIKQAKQVN--------QTHFLFSFMGQANHSD-SGRFTVCRGVKNNKKLGKVVKFAD 253

  Fly   246 GQNHTGWYDGECGRLNGSTTDLFVPDEPKEKALTIFIPDTCRIINLEFTGQSETIQGITGWKYEI 310
            ......|.||||....|:.:.:|.|...||..|..|.||.||.:...:..:| :..|:...:|  
  Fly   254 EPEQDIWPDGECNTFVGTDSTVFAPGLKKEDGLWAFTPDLCRSLGAYYQHKS-SYHGMPSMRY-- 315

  Fly   311 TPNTFDNGQINGNAK--CWCPLERQPDNCPATGATDLGPCADGVPMYLSADHFMYADESYGSTIS 373
               |.|.|.|..:.|  |:|......|.||..|..:|..|..| |:..|..||...|....:.:.
  Fly   316 ---TLDLGDIRADEKLHCFCEDPEDLDTCPPKGTMNLAACVGG-PLMASMPHFYLGDPKLVADVD 376

  Fly   374 GYNPNYDQNNFYIIMERKMGVPLKVNANVMITLYIEPDSVIDILKGLPSFYAPLFTTASRAEIDE 438
            |.|||...:..||..|...|.|.:....:...|.:||...|:.:|.||....|:|......::::
  Fly   377 GLNPNEKDHAVYIDFELMSGTPFQAAKRLQFNLDMEPVEGIEPMKNLPKLILPMFWVEEGVQLNK 441

  Fly   439 ALAS----ELRLALNLPAIGRYTGVGFLCLGCILIAVGILLTIKRKWYGQAELD-KLALKDNEE- 497
            ...:    .|.|.|.:.::.|::.:.|       ..||::.:....::....|| ...||||.: 
  Fly   442 TYTNLVKYTLFLGLKINSVLRWSLITF-------SLVGLMFSAYLFYHKSDSLDINSILKDNNKV 499

  Fly   498 ----TPYEPEVPAN 507
                :..||...||
  Fly   500 DDVASTKEPLPSAN 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaDNP_724087.1 CD36 19..474 CDD:279474 134/489 (27%)
Snmp1NP_001262803.1 CD36 12..478 CDD:279474 134/494 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450731
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11923
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.