DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rngo and NRIP2

DIOPT Version :9

Sequence 1:NP_001285328.1 Gene:rngo / 32616 FlyBaseID:FBgn0030753 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_016875489.1 Gene:NRIP2 / 83714 HGNCID:23078 Length:294 Species:Homo sapiens


Alignment Length:172 Identity:38/172 - (22%)
Similarity:75/172 - (43%) Gaps:38/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 REHITERKRRNEHRMRMLNADPFD----EETQRL-IAEEIKQKN-IQDNMAAAIEYNPE------ 233
            |.|::: :||.:...:.|:.|..|    :..:|| .:::::.:: ||..:   :|.||.      
Human    76 RAHLSQ-QRRLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPRSVIQRRL---VEGNPNWLQGEP 136

  Fly   234 ------IFG----------TVTMLYINCKVNGIPVKAFVDSGAQTTIMSKDCAERCHV-NRLIDT 281
                  |.|          .:..|.:|||.....::..||:|.|...:|..|..|..: .|::..
Human   137 PRMQDLIHGQESRRKTSRTEIPALLVNCKCQDQLLRVAVDTGTQYNRISAGCLSRLGLEKRVLKA 201

  Fly   282 RWNGVAKGVGTQPILGRIHMVQLQIENDHLTSSFTVLGQQPM 323
            ....:|.|..||     :..::||:..:.:..|..|:|:.|:
Human   202 SAGDLAPGPPTQ-----VEQLELQLGQETVVCSAQVVGKSPL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rngoNP_001285328.1 UBQ 1..73 CDD:214563
DDI1_N 3..72 CDD:176391
RP_DDI 225..344 CDD:133146 27/122 (22%)
UBA 411..445 CDD:279021
NRIP2XP_016875489.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.