DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rngo and Nrip3

DIOPT Version :9

Sequence 1:NP_001285328.1 Gene:rngo / 32616 FlyBaseID:FBgn0030753 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_065635.1 Gene:Nrip3 / 78593 MGIID:1925843 Length:240 Species:Mus musculus


Alignment Length:251 Identity:50/251 - (19%)
Similarity:103/251 - (41%) Gaps:61/251 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 DSGDKE---KFARLLREHITERKRRNEHRMRMLNAD-----PFD--------EETQRLIAEEIKQ 217
            :.|.||   :.|..||:     :||.:..::.::.|     |.|        ::||   ...|.|
Mouse     9 EGGRKETDMREAASLRQ-----QRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDTQ---PHNILQ 65

  Fly   218 KNIQDNMAAAIEYNPEIFGTVT------------------MLYINCKVNGIPVKAFVDSGAQTTI 264
            :.:.:...:.:......:.:.|                  |:.::|:..|..|||.||:|.|..:
Mouse    66 RRLMETNLSKLRSTRVPWASKTNKFNQAKSEGLKKCEDEDMILVSCQCAGKDVKALVDTGCQYNL 130

  Fly   265 MSKDCAERCHVNRLIDTRWNGVAKGVGTQ-------PILGRIHMVQLQIENDHLTSSFTVLGQQP 322
            :|..|.:|..:...:.:.     |..|.:       .::|:|..:.:.:.:..|.....|:....
Mouse   131 ISSACVDRLGLKDHVKSH-----KHEGEKLSLPRHLKVVGQIEHLMITVGSLRLDCQAAVVDDNE 190

  Fly   323 MDMLLGLDMLKRHQCLIDLQRNLLIIGTTGTTTPFLPESELPVSARLTGNSEDSME 378
            ..:.|||..|:..:|:|:|.::.||:|.|       .:.|:|....::.|.:::.|
Mouse   191 KSLSLGLQTLRSLKCIINLDKHRLIVGKT-------DKEEIPFVETVSVNDDNTSE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rngoNP_001285328.1 UBQ 1..73 CDD:214563
DDI1_N 3..72 CDD:176391
RP_DDI 225..344 CDD:133146 27/143 (19%)
UBA 411..445 CDD:279021
Nrip3NP_065635.1 NRIP_C 109..211 CDD:133147 25/106 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.