DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rngo and Ddi2

DIOPT Version :9

Sequence 1:NP_001285328.1 Gene:rngo / 32616 FlyBaseID:FBgn0030753 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001017966.1 Gene:Ddi2 / 68817 MGIID:1917244 Length:399 Species:Mus musculus


Alignment Length:391 Identity:190/391 - (48%)
Similarity:260/391 - (66%) Gaps:21/391 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FCLDVAQDLELENLKALCAMEIGAEVSQIAVIFNGRELSSDKQTLQQCGVGDGDFIMLERRRSAN 77
            |.|.|..|.||.|.:|||.:|.|...::..:::..|.|:.:.::|...|:.|||.::|.::.:|:
Mouse    17 FSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQKENAD 81

  Fly    78 -RPVGGNPAISTLDFSNIAVPGTSSGGSPPSRRVQQQGVQQPQFNNLTDIPTTDEFNVNFDDDPE 141
             ||......:..:|||:|||||||   :|..|::.:...|......:...|       ...|:|.
Mouse    82 PRPAVQFSNLPRIDFSSIAVPGTS---NPQQRQLPRTQAQHSSPGEMASSP-------QGLDNPA 136

  Fly   142 TVRQMFLSSPETLSLLRQYNPSLAEAIDSGDKEKFARLLREHITERKRRNEHRMRMLNADPFDEE 206
            .:|.|.|::|..||||::.||.||||:.|||.|||:|:|.|...:|.||.:.|:|:.:|||||.|
Mouse   137 LLRDMLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLE 201

  Fly   207 TQRLIAEEIKQKNIQDNMAAAIEYNPEIFGTVTMLYINCKVNGIPVKAFVDSGAQTTIMSKDCAE 271
            .|..|.|:|:|:||::||..|:|..||.||.|.||||||:|||.|||||||||||.||||:.|||
Mouse   202 AQAKIEEDIRQQNIEENMTIAMEEAPESFGQVAMLYINCRVNGHPVKAFVDSGAQMTIMSQACAE 266

  Fly   272 RCHVNRLIDTRWNGVAKGVGTQPILGRIHMVQLQIENDHLTSSFTVLGQQPMDMLLGLDMLKRHQ 336
            ||::.||:|.||.|:|||||||.|:||:|:.|:|||.|.|..||::|.:||||||||||||||||
Mouse   267 RCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLACSFSILEEQPMDMLLGLDMLKRHQ 331

  Fly   337 CLIDLQRNLLIIGTTGTTTPFLPESELPVSARL---TGNSEDSMEQ-------EAISNAIEQSKR 391
            |.|||::|:|:|||||:.|.||||.|||..|||   ||..:...|:       |||..:.|.::|
Mouse   332 CSIDLKKNVLVIGTTGSQTTFLPEGELPECARLAYGTGREDIRPEEIADQELAEAIQKSAEDAER 396

  Fly   392 E 392
            :
Mouse   397 Q 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rngoNP_001285328.1 UBQ 1..73 CDD:214563 20/59 (34%)
DDI1_N 3..72 CDD:176391 20/58 (34%)
RP_DDI 225..344 CDD:133146 82/118 (69%)
UBA 411..445 CDD:279021
Ddi2NP_001017966.1 DDI1_N 3..76 CDD:176391 20/58 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..134 11/44 (25%)
RP_DDI 221..343 CDD:133146 84/121 (69%)
Ubiquitin-binding. /evidence=ECO:0000305 376..395 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3373
eggNOG 1 0.900 - - E1_KOG0012
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H121661
Inparanoid 1 1.050 355 1.000 Inparanoid score I2225
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54960
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002352
OrthoInspector 1 1.000 - - otm42575
orthoMCL 1 0.900 - - OOG6_101685
Panther 1 1.100 - - O PTHR12917
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2086
SonicParanoid 1 1.000 - - X1784
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.