DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rngo and Nrip2

DIOPT Version :9

Sequence 1:NP_001285328.1 Gene:rngo / 32616 FlyBaseID:FBgn0030753 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001156330.1 Gene:Nrip2 / 60345 MGIID:1891884 Length:270 Species:Mus musculus


Alignment Length:222 Identity:48/222 - (21%)
Similarity:89/222 - (40%) Gaps:34/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 DSGD--KEKFARLL-REHITERKRRNEHRMRMLNADPFD----EETQRLIAEE-------IKQKN 219
            |.||  ||:.|.|. |.|::: :|:.:...:.|:.|..|    :..:||...:       |:::.
Mouse    10 DEGDSRKEQEASLRDRAHLSQ-QRQLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPHSVIQRRL 73

  Fly   220 IQDNMAAAIEYNPEIFG-------------TVTMLYINCKVNGIPVKAFVDSGAQTTIMSKDCAE 271
            ::.|.......:|.:..             .|..|.:|||.....::..||:|.|...:|..|..
Mouse    74 VEGNQRRLQGESPLLQALIRGHDSSRTSATQVPALLVNCKCQDQMLRVAVDTGTQHNQISAGCLR 138

  Fly   272 RCHVNRLIDTRWNG-VAKGVGTQPILGRIHMVQLQIENDHLTSSFTVLGQQPMDMLLGLDMLKRH 335
            |..:.:.:.....| ||....||     :..::|::..:.:..|..|:.....:..|||..|...
Mouse   139 RLGLGKRVPKAPGGDVAPEPPTQ-----VEQLELELGQETVACSAQVVDVDSPEFCLGLQTLLSL 198

  Fly   336 QCLIDLQRNLLIIGTTGTTTPFLPESE 362
            :....|..:.|:....|..|..:.:||
Mouse   199 KLATSLSASSLLPSALGIPTESICDSE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rngoNP_001285328.1 UBQ 1..73 CDD:214563
DDI1_N 3..72 CDD:176391
RP_DDI 225..344 CDD:133146 26/132 (20%)
UBA 411..445 CDD:279021
Nrip2NP_001156330.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 9/23 (39%)
Interaction with NR1F2. /evidence=ECO:0000269|PubMed:10860982 61..99 3/37 (8%)
pepsin_retropepsin_like 110..199 CDD:299705 22/93 (24%)
LXXLL motif 192..196 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.