DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rngo and NRIP3

DIOPT Version :9

Sequence 1:NP_001285328.1 Gene:rngo / 32616 FlyBaseID:FBgn0030753 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_065696.1 Gene:NRIP3 / 56675 HGNCID:1167 Length:241 Species:Homo sapiens


Alignment Length:253 Identity:52/253 - (20%)
Similarity:106/253 - (41%) Gaps:57/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 ETLSLLRQYNPSLAEAI-----DSGD--------KEKFARLLREHITERKRRNEHRMRMLNAD-- 201
            |..||.:|..  :.:|:     ||.|        |...::.::.|...::|..|..:..|.:.  
Human    19 EAASLRQQRR--MKQAVQFIHKDSADLLPLDGLKKLGSSKDMQPHNILQRRLMETNLSKLRSGPR 81

  Fly   202 -PFDEETQRL---IAEEIKQKNIQDNMAAAIEYNPEIFGTVTMLYINCKVNGIPVKAFVDSGAQT 262
             |:..:|.:|   .:|.:|:....|                 |:.::|:..|..|||.||:|...
Human    82 VPWASKTNKLNQAKSEGLKKSEEDD-----------------MILVSCQCAGKDVKALVDTGCLY 129

  Fly   263 TIMSKDCAERCHVNRLIDTRWNGVAKGVGTQ-------PILGRIHMVQLQIENDHLTSSFTVLGQ 320
            .::|..|.:|..:...:.:.     |..|.:       .::|:|..:.:.:.:..|.....|:..
Human   130 NLISLACVDRLGLKEHVKSH-----KHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDD 189

  Fly   321 QPMDMLLGLDMLKRHQCLIDLQRNLLIIGTTGTTTPFLPESELPVSARLTGNSEDSME 378
            ...::.|||..|:..:|:|:|.::.||:|.|       .:.|:|....::.|.:::.|
Human   190 NEKNLSLGLQTLRSLKCIINLDKHRLIMGKT-------DKEEIPFVETVSLNEDNTSE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rngoNP_001285328.1 UBQ 1..73 CDD:214563
DDI1_N 3..72 CDD:176391
RP_DDI 225..344 CDD:133146 25/125 (20%)
UBA 411..445 CDD:279021
NRIP3NP_065696.1 NRIP_C 110..212 CDD:133147 24/106 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.