DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rngo and nrip2

DIOPT Version :9

Sequence 1:NP_001285328.1 Gene:rngo / 32616 FlyBaseID:FBgn0030753 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001116987.1 Gene:nrip2 / 565865 ZFINID:ZDB-GENE-030131-9425 Length:296 Species:Danio rerio


Alignment Length:283 Identity:59/283 - (20%)
Similarity:115/283 - (40%) Gaps:52/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 QQQGVQQ-PQFN-----NLTDIPTTDEFNVNFDDDPETVRQMFL---SSP----ETLSLLRQYNP 162
            ||:.::| .||.     :|..:........:.|..|.::.|..|   :.|    ||..:......
Zfish    18 QQRRLKQATQFTHKDSADLLPLDGLKRMGTSKDLQPHSIVQRRLLEGNIPRLRGETRDIPSHVRS 82

  Fly   163 SLAEAIDSGDKEKFARLLREHITERKRRNEHRMRMLNAD-PFDEETQRLIAE----------EIK 216
            .||::.:.|:.|:.:....:..||.:...|...:.|.:| ..|:|.:...::          |.:
Zfish    83 PLADSKEPGEPEERSESTVDDSTEERESPEESEKSLRSDEDGDDEDEGDSSDAGGKTDSKQKEQR 147

  Fly   217 QKNIQDNMAAAIEYNPEIFGTVTMLYINCKVNGIPVKAFVDSGAQTTIMSKDCAERCHVNRLIDT 281
            :|.:::...||         :::.|.:.||.....|...:::|.|...:||.|..|      :..
Zfish   148 KKELKEGERAA---------SLSALVVQCKCGDAEVMLSINTGCQHNHISKTCCRR------LGL 197

  Fly   282 RWNGVAKGVGTQPI-----LGRIHMVQLQIENDHLTSSFTVLGQQPMDMLLGLDMLKRHQCLIDL 341
            :.....||...||:     :..:..:|||:..:.:..:..|:.....::.|||..|...:|.:||
Zfish   198 KSKQEDKGRDKQPVSESSPVETVKSLQLQLGRERVQCTAQVIEDATFEVCLGLQTLLELKCCVDL 262

  Fly   342 QRNLLIIGTTGTTTPFLPESELP 364
            :..:|.:.:        ||.|||
Zfish   263 KSRVLRLHS--------PEQELP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rngoNP_001285328.1 UBQ 1..73 CDD:214563
DDI1_N 3..72 CDD:176391
RP_DDI 225..344 CDD:133146 27/123 (22%)
UBA 411..445 CDD:279021
nrip2NP_001116987.1 pepsin_retropepsin_like 165..262 CDD:299705 22/102 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.