DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rngo and DDI1

DIOPT Version :9

Sequence 1:NP_001285328.1 Gene:rngo / 32616 FlyBaseID:FBgn0030753 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001001711.1 Gene:DDI1 / 414301 HGNCID:18961 Length:396 Species:Homo sapiens


Alignment Length:401 Identity:192/401 - (47%)
Similarity:252/401 - (62%) Gaps:15/401 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKITV----TTSDDKVFCLDVAQDLELENLKALCAMEIGAEVSQIAVIFNGRELSSDKQTLQQCG 61
            |.|||    ....:..|.|.|:.|.||.|.|.||..|....|.:|.:|...|.|..|..:|...|
Human     1 MLITVYCVRRDLSEVTFSLQVSPDFELRNFKVLCEAESRVPVEEIQIIHMERLLIEDHCSLGSYG 65

  Fly    62 VGDGDF-IMLERRRSANRPVGGNPAISTLDFSNIAVPGTSSGGSPPSRRVQQQGVQQ---PQFNN 122
            :.|||. ::|::.....|..|..|....:|||.||||||||.      |.|..|.||   |....
Human    66 LKDGDIVVLLQKDNVGPRAPGRAPNQPRVDFSGIAVPGTSSS------RPQHPGQQQQRTPAAQR 124

  Fly   123 LTDIPTTDEF-NVNFDDDPETVRQMFLSSPETLSLLRQYNPSLAEAIDSGDKEKFARLLREHITE 186
            ...:.:.::. .:.....|..:|.|.||:|..||||::.||.||||:.||..|.|:::|.|...|
Human   125 SQGLASGEKVAGLQGLGSPALIRSMLLSNPHDLSLLKERNPPLAEALLSGSLETFSQVLMEQQRE 189

  Fly   187 RKRRNEHRMRMLNADPFDEETQRLIAEEIKQKNIQDNMAAAIEYNPEIFGTVTMLYINCKVNGIP 251
            :..|.:.|:|:..|||.|.|.|..|.|||:|:||::||..|||..||.||.||||||||||||.|
Human   190 KALREQERLRLYTADPLDREAQAKIEEEIRQQNIEENMNIAIEEAPESFGQVTMLYINCKVNGHP 254

  Fly   252 VKAFVDSGAQTTIMSKDCAERCHVNRLIDTRWNGVAKGVGTQPILGRIHMVQLQIENDHLTSSFT 316
            :|||||||||.||||:.|||||::.||:|.||.|||||||||.|:||:|:.|:|||.|.|..||:
Human   255 LKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRVHLAQIQIEGDFLQCSFS 319

  Fly   317 VLGQQPMDMLLGLDMLKRHQCLIDLQRNLLIIGTTGTTTPFLPESELPVSARLTGNSEDSMEQEA 381
            :|..||||||||||||:||||.|||::|:|:||||||.|.||||.|||:.:|:....::|.::|.
Human   320 ILEDQPMDMLLGLDMLRRHQCSIDLKKNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEI 384

  Fly   382 ISNAIEQSKRE 392
            ..:.::..::|
Human   385 THSVMDSGRKE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rngoNP_001285328.1 UBQ 1..73 CDD:214563 27/76 (36%)
DDI1_N 3..72 CDD:176391 26/73 (36%)
RP_DDI 225..344 CDD:133146 84/118 (71%)
UBA 411..445 CDD:279021
DDI1NP_001001711.1 UBQ 1..>215 CDD:333228 79/219 (36%)
DDI1_N 3..76 CDD:176391 25/72 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..130 20/53 (38%)
RP_DDI 229..351 CDD:133146 86/121 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..396 3/22 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147165
Domainoid 1 1.000 185 1.000 Domainoid score I3384
eggNOG 1 0.900 - - E1_KOG0012
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 358 1.000 Inparanoid score I2227
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54960
OrthoDB 1 1.010 - - D495103at33208
OrthoFinder 1 1.000 - - FOG0002352
OrthoInspector 1 1.000 - - otm40502
orthoMCL 1 0.900 - - OOG6_101685
Panther 1 1.100 - - O PTHR12917
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2086
SonicParanoid 1 1.000 - - X1784
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.