DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rngo and Ddi2

DIOPT Version :9

Sequence 1:NP_001285328.1 Gene:rngo / 32616 FlyBaseID:FBgn0030753 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_006239367.1 Gene:Ddi2 / 313668 RGDID:1311815 Length:986 Species:Rattus norvegicus


Alignment Length:400 Identity:195/400 - (48%)
Similarity:263/400 - (65%) Gaps:26/400 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FCLDVAQDLELENLKALCAMEIGAEVSQIAVIFNGRELSSDKQTLQQCGVGDGDFIMLERRRSAN 77
            |.|.|..|.||.|.:|||.:|.|...::..:::..|.|:.:.::|...|:.|||.::|.::.:|:
  Rat    17 FSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQKENAD 81

  Fly    78 -RPVGGNPAISTLDFSNIAVPGTSSGGSPPSRRVQQQGVQQPQFNNLTDIPTTDEFNVNFDDDPE 141
             ||......:..:|||:|||||||   :|..|::.:...|.......|..|       ...|.|.
  Rat    82 PRPSVQFSNLPRIDFSSIAVPGTS---NPQQRQLPRTQAQLLSPGERTSTP-------QGLDSPA 136

  Fly   142 TVRQMFLSSPETLSLLRQYNPSLAEAIDSGDKEKFARLLREHITERKRRNEHRMRMLNADPFDEE 206
            .:|.|.|::|..||||::.||.||||:.|||.|||:|:|.|...:|.||.:.|:|:.:|||||.|
  Rat   137 LLRDMLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLE 201

  Fly   207 TQRLIAEEIKQKNIQDNMAAAIEYNPEIFGTVTMLYINCKVNGIPVKAFVDSGAQTTIMSKDCAE 271
            .|..|.|:|:|:||::||..|:|..||.||.|.||||||:|||.|||||||||||.||||:.|||
  Rat   202 AQAKIEEDIRQQNIEENMTIAMEEAPESFGQVAMLYINCRVNGHPVKAFVDSGAQMTIMSQACAE 266

  Fly   272 RCHVNRLIDTRWNGVAKGVGTQPILGRIHMVQLQIENDHLTSSFTVLGQQPMDMLLGLDMLKRHQ 336
            ||::.||:|.||.|:|||||||.|:||:|:.|:|||.|.|..||::|.:||||||||||||||||
  Rat   267 RCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLACSFSILEEQPMDMLLGLDMLKRHQ 331

  Fly   337 CLIDLQRNLLIIGTTGTTTPFLPESELPVSARL---TGNS----EDSMEQEAISNAI-------E 387
            |.|||::|:|:|||||:.|.||||.|||..|||   ||..    |:..:|| ::.||       |
  Rat   332 CSIDLKKNVLVIGTTGSQTTFLPEGELPECARLAYGTGREDIRPEEIADQE-LAEAIQKSAEDAE 395

  Fly   388 QSKRESGGAG 397
            :|.:||...|
  Rat   396 KSSKESTSLG 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rngoNP_001285328.1 UBQ 1..73 CDD:214563 20/59 (34%)
DDI1_N 3..72 CDD:176391 20/58 (34%)
RP_DDI 225..344 CDD:133146 82/118 (69%)
UBA 411..445 CDD:279021
Ddi2XP_006239367.1 UBQ 1..74 CDD:214563 19/56 (34%)
DDI1_N 3..76 CDD:176391 20/58 (34%)
RP_DDI 221..343 CDD:133146 84/121 (69%)
CytochromB561_N <387..>535 CDD:286826 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3294
eggNOG 1 0.900 - - E1_KOG0012
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H121661
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495103at33208
OrthoFinder 1 1.000 - - FOG0002352
OrthoInspector 1 1.000 - - otm44645
orthoMCL 1 0.900 - - OOG6_101685
Panther 1 1.100 - - O PTHR12917
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1784
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.