DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rngo and SPAC56F8.07

DIOPT Version :9

Sequence 1:NP_001285328.1 Gene:rngo / 32616 FlyBaseID:FBgn0030753 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_593222.2 Gene:SPAC56F8.07 / 2543225 PomBaseID:SPAC56F8.07 Length:183 Species:Schizosaccharomyces pombe


Alignment Length:101 Identity:27/101 - (26%)
Similarity:39/101 - (38%) Gaps:22/101 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 RIHMVQLQIEN--DHLTSSFTVLGQQPMDMLLGLDMLKRHQCLIDLQR--------NLLIIGTTG 352
            |:||..|....  .||.::..|  ..|:...||..:    .||..|:|        .:|:|....
pombe    21 RLHMDTLYYYYFVSHLAAALFV--DLPITEWLGGSL----SCLSGLRRFYLSTYEDPILLIPAPW 79

  Fly   353 TTTPFLPE--SELP----VSARLTGNSEDSMEQEAI 382
            .|..|..|  .::|    ||.||...:.|.:...||
pombe    80 KTALFSSELFFQVPFFIWVSLRLRKKARDPVLWVAI 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rngoNP_001285328.1 UBQ 1..73 CDD:214563
DDI1_N 3..72 CDD:176391
RP_DDI 225..344 CDD:133146 14/55 (25%)
UBA 411..445 CDD:279021
SPAC56F8.07NP_593222.2 DUF2781 25..162 CDD:287833 24/97 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.