DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31773 and FOL3

DIOPT Version :9

Sequence 1:NP_722953.1 Gene:CG31773 / 326159 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_013831.1 Gene:FOL3 / 855140 SGDID:S000004719 Length:427 Species:Saccharomyces cerevisiae


Alignment Length:336 Identity:74/336 - (22%)
Similarity:136/336 - (40%) Gaps:90/336 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 IEQTLECLEKSGLTKKDLKAIPVIQVAGSKGRGSTCAIVESILRCHGVKTGVLSSPHLFLTSERI 373
            :.:..:.||..|..:..|:   |:.:||:.|:||.|..:.|:|:....:.|..::|||...::.|
Yeast     7 LSRITKLLEHLGNPQNSLR---VLHIAGTNGKGSVCTYLSSVLQQKSYQIGKFTTPHLVHVTDSI 68

  Fly   374 RIDGEPLSDVQFTELFWKINTDLANMQPTPSYN----KIMTVMAFHAFHQAGVEVAILEVGNAGA 434
            .|:.:|:.    .|.:..|...|..:..:.|..    :::|..||..|:....:..::|||..|.
Yeast    69 TINNKPIP----LERYQNIRLQLEALNKSHSLKCTEFELLTCTAFKYFYDVQCQWCVIEVGLGGR 129

  Fly   435 SDATNI--ASHAQTIGITTLGWEQSSNLGNSLRDIAWAKASIMKPEA--NIYTNVTQTECCEVLA 495
            .||||:  .::....|||.:..:..|.|||:|.:|:..||.|:....  .:.....:.....|:.
Yeast   130 LDATNVIPGANKACCGITKISLDHESFLGNTLSEISKEKAGIITEGVPFTVIDGTNEASVINVVK 194

  Fly   496 QKAKQIGAQ----------------------LRRVP------TFN--------DYVEGDMNNKLL 524
            ::.|.:|::                      |.::|      .||        ||::  ||..:.
Yeast   195 ERCKALGSELSVTDSQLNGNMIDTNSWGCFDLAKLPLNGEYQIFNLRVAMGMLDYLQ--MNELID 257

  Fly   525 MNKANYSMRL--------------------------------NGSLAVQLAYDFLKR---HKP-E 553
            :.|...|.||                                |||.||:|. .:|::   ::| .
Yeast   258 ITKNEVSTRLAKVDWPGRLYRMDYRFDKVSNRTVPILMDGAHNGSAAVELV-KYLRKEYGNQPLT 321

  Fly   554 YVVGLEHNSTL 564
            :|:.:.|...|
Yeast   322 FVMAVTHGKNL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31773NP_722953.1 folC 309..745 CDD:273659 74/336 (22%)
FOL3NP_013831.1 FolC 3..427 CDD:223362 74/336 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346400
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0285
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1575
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001698
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.690

Return to query results.
Submit another query.