DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31773 and Fpgs

DIOPT Version :9

Sequence 1:NP_722953.1 Gene:CG31773 / 326159 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster
Sequence 2:XP_038961794.1 Gene:Fpgs / 687266 RGDID:1587713 Length:676 Species:Rattus norvegicus


Alignment Length:420 Identity:142/420 - (33%)
Similarity:209/420 - (49%) Gaps:41/420 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PAEKPEEKSPEHLAYLDAIKQLNSYQVLEPTSGRATTKSSRKEQDPVIEQTLECLE----KSGLT 322
            ||  |:|.|.|   |.||::.||:.|    |:.....:..|:..||  :..||.:|    :|||.
  Rat    36 PA--PQEPSME---YQDAVRTLNTLQ----TNASCLEEVKRQRSDP--QAQLEAMEVYLARSGLQ 89

  Fly   323 KKDLKAIPVIQVAGSKGRGSTCAIVESILRCHGVKTGVLSSPHLFLTSERIRIDGEPLSDVQFTE 387
            .:||..:.:|.|.|:||:|||||..|.|||.:|:|||..|||||....|||||:|:|:|...||:
  Rat    90 VEDLNQLKIIHVTGTKGKGSTCAFTERILRNYGLKTGFFSSPHLVQVRERIRINGKPISPELFTK 154

  Fly   388 LFWKINTDLANMQ-----PTPSYNKIMTVMAFHAFHQAGVEVAILEVGNAGASDATNIASHAQTI 447
            .||.:...|...:     ..|||.:.:|:||||.|.|..|::|::|||..||.|.|||.......
  Rat   155 YFWHLYQQLEEFKDDSHISMPSYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAFDCTNIIRKPVVC 219

  Fly   448 GITTLGWEQSSNLGNSLRDIAWAKASIMKPEANIYTNVTQTECCEVLAQKAKQIGAQLRRVPTFN 512
            |:::||.:.:|.||:::..|||.|..|.||....:|.:.......||..:|:||...|...|...
  Rat   220 GVSSLGIDHTSLLGDTVEKIAWQKGGIFKPGVPAFTVLQPEGPLAVLRDRAQQISCPLYLCPPLE 284

  Fly   513 DYVEGDMNNKLLMNKANYSMRLNGSLAVQLAYDFLKRHKPEYVVGLEHNSTLL------------ 565
            ...:  :...|.:.......|.|.:||:|||..:|::.....:..|:.:...:            
  Rat   285 ALEQ--VGLPLSLGLEGEHQRHNAALALQLARCWLEQQNYHDIQELKASKPSIRWQLPLAPVFRP 347

  Fly   566 TPGASRGIEIFEQPGHFDFMRHDMFNVYLDSADTFESMMACRDWF------YTRTRANRQPKILL 624
            ||...||:...|.||....::......|||.|.|..|:.||..|:      ..||....:..|||
  Rat   348 TPHMRRGLRDTEWPGRTQVLQRGPVTWYLDGAHTTSSVQACVHWYCQSLERSRRTDGGHEVHILL 412

  Fly   625 FNKVNEFNAKDLLTIIRSNLRFEEACFVPN 654
            ||...:.::..||.:::. ..|:.|.|.||
  Rat   413 FNSTGDRDSAALLKLLQP-CHFDYAVFCPN 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31773NP_722953.1 folC 309..745 CDD:273659 126/373 (34%)
FpgsXP_038961794.1 PLN02881 42..670 CDD:215476 138/412 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 157 1.000 Domainoid score I4068
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4187
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D231485at33208
OrthoFinder 1 1.000 - - FOG0001698
OrthoInspector 1 1.000 - - otm45686
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2113
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.